Entry information : EcamPrx[P]169(EcC010500.20)
Entry ID 10386
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2020-02-13 (Christophe Dunand)
Peroxidase information: EcamPrx[P]169(EcC010500.20)
Name EcamPrx[P]169(EcC010500.20)
Class Class III peroxidase    [Orthogroup: Prx104]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]169
start..stop
S start..stop
EglPrx[P]169 668 0 1..339 1..339
EguPrx[P]169 589 0 40..339 1..300
EgrPrx169 558 0 1..339 1..320
EcamPrx200 538 0 1..339 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..276 276 N° 2 657..848 192 N° 3 938..1489 552  
join(1..276,657..848,938..1489)


exon

Literature and cross-references EcamPrx[P]169(EcC010500.20)
Protein sequence: EcamPrx[P]169(EcC010500.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (314)
PWM (Da):   %s   36831.18 (34071.7) Transmb domain:   %s   i42-64o (i21-43o)
PI (pH):   %s   7.98 (6.89) Peptide Signal:   %s   cut: 26 range:26-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNTNRKIYFAFFVCAIALRSALAQLSNQDYYTQRCPRASLFRFLAQFYPFSFMSSFVYVLHVLLRANFYFIPNPYMDYSSSTFIFDGSSHGCDASILLDDTVNFTGEKTAFPNMNSVRGFDVIDTIKLKVEKLCPGVVSCADILAIAAKDSVVILDGPSWQVQLGRRDSTTASLNDANIDLPAPTLNLSGLVTSFSNKGFTAKEMVTLSGSHTIGQARCVTFRTRLYNESNISPSFAMSLKSNCPGSGGDNNISPLDITSPTFFDNAYFSNLVSQEGLLHSDQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN*

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (introns 1 and 2). End of Exon 1 is missing (No FHDC)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGCCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
AGTCTCTTCCGCTTTCTCGCTCAGTTCTATCCTTTTTCCTTCATGTCCAGTTTCGTGTATGTTTTGCATGTTCTTTTACGTGCAAACTTTTACTTCATTCCCAATCCATATATGGATTAC
TCTTCCTCCACGTTTATTTTCGATGGTTCCTCGCAT
GTCTGCTTAATTCACTCCTGATTGAAAATGGCCAACATTTTGGAGATTCGGATCTTTGAGGAATATTGCAACAAGTGAGCTACG
TGGGCCAATGATTCCATTAAATTAAGAAAGAACACGCATTGAGCTGATCATAGCACACCATTTAGACGACCTGCCAATCTTGTGTCTCTAACTATGTCTTTTTTCATGCACAATATATAA
TTGTCTCCATACTTATTCTATTCTAACCGATGAATTGTCTCTCTCTTAACGTTCCTTTCCGGTTGCTTGCAAAAAAAAATTATTTTGTTTCCTCATAGGTTCAATATTTAGATCATCCTC
TCTAGTTCGTTAGATCTTCTAAACTTAATAAGATGTTAATTTTTTTTTTTTGATAGGGATGTGATGCATCCATTCTACTAGATGACACCGTGAACTTCACTGGGGAGAAGACAGCGTTTC
CCAACATGAACTCCGTGAGGGGATTCGATGTGATTGACACTATCAAGTTAAAAGTGGAGAAACTATGTCCTGGCGTTGTCTCGTGCGCTGACATCTTAGCCATTGCTGCTAAGGACTCCG
TCGTCATT
GTAAGCATTGACACTTGAAATTTCTTTAAACATACAAAGAAACTATTATTTTCCTAAACTTATGTGGATTCAATTAATTTGATGTTTAGTTGGATGGACCGAGTTGGCAAGT
CCAACTGGGAAGAAGAGACTCAACCACAGCGAGCCTAAATGATGCTAATATCGACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCACCTCTTTCTCTAACAAAGGCTTTACTGC
TAAAGAAATGGTAACGCTATCAGGATCCCACACCATAGGCCAGGCTAGGTGCGTGACGTTTCGGACCCGACTCTACAACGAGAGCAATATAAGCCCATCATTCGCCATGTCTTTAAAGTC
CAATTGCCCCGGCTCTGGAGGCGACAACAACATATCCCCTCTCGACATCACAAGCCCGACGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGA
TCAACAGTTGTTTAGTGGAGGTTCGACGAATGCTCAAGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCT
TACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGCCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
AGTCTCTTCCGCTTTCTCGCTCAGTTCTATCCTTTTTCCTTCATGTCCAGTTTCGTGTATGTTTTGCATGTTCTTTTACGTGCAAACTTTTACTTCATTCCCAATCCATATATGGATTAC
TCTTCCTCCACGTTTATTTTCGATGGTTCCTCGCAT
GGATGTGATGCATCCATTCTACTAGATGACACCGTGAACTTCACTGGGGAGAAGACAGCGTTTCCCAACATGAACTCCGTGAGG
GGATTCGATGTGATTGACACTATCAAGTTAAAAGTGGAGAAACTATGTCCTGGCGTTGTCTCGTGCGCTGACATCTTAGCCATTGCTGCTAAGGACTCCGTCGTCATT
TTGGATGGACCG
AGTTGGCAAGTCCAACTGGGAAGAAGAGACTCAACCACAGCGAGCCTAAATGATGCTAATATCGACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCACCTCTTTCTCTAACAAA
GGCTTTACTGCTAAAGAAATGGTAACGCTATCAGGATCCCACACCATAGGCCAGGCTAGGTGCGTGACGTTTCGGACCCGACTCTACAACGAGAGCAATATAAGCCCATCATTCGCCATG
TCTTTAAAGTCCAATTGCCCCGGCTCTGGAGGCGACAACAACATATCCCCTCTCGACATCACAAGCCCGACGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTG
CTTCATTCGGATCAACAGTTGTTTAGTGGAGGTTCGACGAATGCTCAAGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGC
CTTAGTCCTCTTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAATTGA

Retrieve as FASTA