Entry information : EcamPrx09 (EcC012499.70)
Entry ID 10389
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: EcamPrx09 (EcC012499.70)
Name (synonym) EcamPrx09 (EcC012499.70)
Class Class III peroxidase    [Orthogroup: Prx120]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx09
start..stop
S start..stop
EgrPrx09 610 0 1..333 1..334
EglPrx09 603 0 1..333 1..335
EgrPrx08 543 0 1..333 1..337
EglPrx08 525 0 1..333 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..30 30 N° 2 90..248 159 N° 3 451..636 186 N° 4 852..936 85
N° 5 1217..1626 410  
join(1..30,90..248,451..636,852..936,1217..1626)


exon

Literature and cross-references EcamPrx09 (EcC012499.70)
Protein sequence: EcamPrx09 (EcC012499.70)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (306)
PWM (Da):   %s   36679.36 (33594.7)  
PI (pH):   %s   8.61 (7.97) Peptide Signal:   %s   cut: 28 range:28-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWRLLLLAVLALMSSCAMRRVEAAVGIQPPEKLQWHFYQNSCRDAERYVRNQVEFYWKLDRSLAPKLIRMLYSDCFVTGCDASILLDGPYSEKTAPQNAGLLGFPMAVIDKIKQVPEQRCPGVVSCADILNFAARDAAHLAGGPSYPVLAGRKDGMSSSAALVDLPLGAVPWGSALAYFESRGLDVLDLTTLLGGHSMGKTNCSFIVDRLYNFNNTGKPDPSMDSSFLAQMRVQCPPNSKNQVYLDPDSGSSYSFSKSYSRVLNHRAVLGIDQQIAANNDSSQIAEEYNASFEDFRKIFALSMSRMGNIKVSTGNRGEIRKNCRVVNRK

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa. containing motif ysdc
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTAGTTGTCGCTGGCGGCGCTTGCGTTGGTGAGCTCGTCTGCCGTGTGGCGTGTCTAGGCGGCAGTGGCATTGAGCCGCCACAGAAGCTGCAGTGGC
ATTACTACCGGAACTCGTGCCGCGACGCCGAGAGGTACGTTAGCACCCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTCGCGTCCAAGCCCATCCGAATGCTCTATGCCGATTGCT
TCGTCACG
GTACATTTCTTATCCTCTCTCGAACGATCTATCAGTCCGCATCACTTCAATAACAAGTTTTCATCGCCCTTCTAAGCACGTGATATCCTTTCACCCAACGGTTTAACCTCTT
GAACCAGGCTTTCTTACATACCACTCTTGTGTACGTATATATAAAACAAAGCCTTGGACTCAGATATGTTTGGTTATGCATACAAAACAGGGGTGCGATGCGTTGATTCTATCAGACCGG
CCATATTCAGAGAAAACAGCACCGCAAAATGCAGATCTTCTAGGGTTTCCTATGGCGGTGATGGACAAGATCAAGCAAGTCCTGGAACAACATTGTCCAGGAGTCGTCTGTTGTGCTGAC
ATACTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GTATGTACCTGGTTTGCACTTCTCTCTTTTGGCTTGAAAAGACGTTTTCGCTGCACTGGTTATTGACATGCTGTTAGCTTGAGC
TTGTAGGGTTAGATGTGGAAAATTAGCAGTGCTGATGTGATAATAATGTTGAAATAGGCGGGAGGGCTGTCGTACCCTTTTCTAGCGGGGAGGAGGGACGGGATGTCGTCCTCCGTGGCG
TCGGTGGACCTCCCATTGGGGGCCACCCTTGGGGATCGGTGCTCGCTTACTTCGAATCAAGAGGCTTGGATGTGCTGGATCTTGTTACTCTACTCGGTACGATCGACCCTCATGTGAAAA
CGTATTTATTTGACTTGTGACCTCATTAAATTACCTTAGATCTTAGCAATTCCTTTTCGAATTTAATTTTTCGAAATCTCCATCTAATTGTTGGGATACATAGAGTTTTATCATATATAG
GATAGTCGAGAATATAATCCGAACTGATCCTCCTAATGATACCTCCAAGTGCACGAAGCAACATGTTTATGTACTATGTCATATCTCAAAATCAGAACCAATTCCTAACTTGCCAAAACA
ATGTAAACTTTGCAAGGAGGGCATTCAATGGGCAAGACCAGCTGCAGCTTCATCGCGGACCGGCTGTACAATTTCAACAAAATTGGCAAGCCAGACCCAAGCATGGACTCATCCTTCTTG
GCCCAGATGAGGGAGCAAGGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGATTCAGGTTCCAGCTACAGCTTCAGCAAGTCATTCTACTCCGGGGTCCTGAACCACCGTGTC
GTCCTCGGCATCGACCAGCAGATCACCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTTCAATGCCAGTTTTGAGGACTTCCGGAAGATGTTCGCCCTATCGATGAGCCGGATGGGG
AACATCAAGGTCTTGCCGTGGAAGCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTAGTTGGGCATTGAGCCGCCACAGAAGCTGCAGTGGCATTACTACCGGAACTCGTGCCGCGACGCCGAGAGGTACGTTAGCACCCAGGTCGAGTTC
TACTGGAAGCTGGACAGGAGCCTCGCGTCCAAGCCCATCCGAATGCTCTATGCCGATTGCTTCGTCACG
GGGTGCGATGCGTTGATTCTATCAGACCGGCCATATTCAGAGAAAACAGCA
CCGCAAAATGCAGATCTTCTAGGGTTTCCTATGGCGGTGATGGACAAGATCAAGCAAGTCCTGGAACAACATTGTCCAGGAGTCGTCTGTTGTGCTGACATACTCAACTTTGCCGCTAGA
GATGCTGCTCACTTG
CCCATTGGGGGCCACCCTTGGGGATCGGTGCTCGCTTACTTCGAATCAAGAGGCTTGGATGTGCTGGATCTTGTTACTCTACTCGGAGGGCATTCAATGGGCAAG
ACCAGCTGCAGCTTCATCGCGGACCGGCTGTACAATTTCAACAAAATTGGCAAGCCAGACCCAAGCATGGACTCATCCTTCTTGGCCCAGATGAGGGAGCAAGGCCCACCGAACTCAAAG
AATCAAGTGTACCTTGACCCTGATTCAGGTTCCAGCTACAGCTTCAGCAAGTCATTCTACTCCGGGGTCCTGAACCACCGTGTCGTCCTCGGCATCGACCAGCAGATCACCGCCAACAAC
GACAGCTCCCAGATCGCTGAGGAGTTCAATGCCAGTTTTGAGGACTTCCGGAAGATGTTCGCCCTATCGATGAGCCGGATGGGGAACATCAAGGTCTTGCCGTGGAAGCAGGGGGAGATT
CGCAAGAATTGCCGAGTCGTGAACGGGAAG

Retrieve as FASTA