Entry information : EcamPrx55 ( EcC014837.10)
Entry ID 10391
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-01-18 (Achraf Jemmat)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-01-18 (Achraf Jemmat)
Peroxidase information: EcamPrx55 ( EcC014837.10)
Name (synonym) EcamPrx55 ( EcC014837.10)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx55
start..stop
S start..stop
EguPrx55 650 0 1..332 1..333
EglPrx55 647 0 1..332 1..333
EgrPrx55 644 0 1..332 1..333
MePrx53 512 0 3..332 5..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 363..548 186 N° 3 677..848 172 N° 4 1201..1617 417
join(1..225,363..548,677..848,1201..1617)


exon

Literature and cross-references EcamPrx55 ( EcC014837.10)
Protein sequence: EcamPrx55 ( EcC014837.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (304)
PWM (Da):   %s   34846.03 (31854.5)  
PI (pH):   %s   5.15 (4.56) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRSHAPSSLMGIAVFAALLFLLHPSSAQLSSNFYATSCPNVSNIVQTVIQQALQSDPRITASLLRLHFHDCFVDGV*WIVVAGQQRKH*Q*ERRSSEYKFDKRVRCGGQHQISHRELLSWDRVLRRHSRPRCSSFCIAVRRSILDGALGEEGQLDGEPSRSEHIDT*PFWFLG*PHFPIRRCWIGHQ*PCHSFRSSHLWTCTMQDIQP*ALQLHQWRPRSHHKSFILDHSPTTLPTEWKRLRPRQPRPDDREHIRQQLLHQPPEQPRASSVRSRAVLNIWRRNDLHRQQLQRQPERLLPELCSIDDKHGKH*SSHRK*WGDQIELQEGQRX

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa (Short 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCCGTTCTCACGCTCCTTCCTCGCTGATGGGGATAGCGGTTTTCGCCGCGTTGTTGTTTCTCCTCCATCCGTCGAGTGCTCAATTAAGCTCAAACTTTTATGCCACATCATGCCCG
AATGTGTCCAACATCGTCCAAACCGTGATCCAGCAGGCCCTTCAATCCGACCCGCGCATCACCGCCAGCCTCCTCCGTCTCCATTTCCACGATTGCTTTGTTGAC
GTGAGTCCCTAAGCT
TGGTCTTGGTCAACTCCCGTTAACAGCGTGTCCTAAATTAAGCGTTTTTCGTTTTGACTTTCAATCCGATTATCGGGTAGTTAGTCACTTGAACTAACGTTTGAGCATACTATGTGTTGA
CAGGGGTGTGATGGATCGTTGTTGCTGGACAACAGCGCAAACATTAGCAGTGAGAAAGACGCAGCTCCGAATACAAATTCGACAAGAGGGTTCGATGTGGTGGACAACATCAAATCAGCC
ATCGAGAGCTCTTGTCCTGGGACCGTGTCTTGCGCCGACATTCTCGCCCTCGGTGCTCAAGCTTCTGT
CGTTCTGGTAGACATAGCTATAGTCAAAGAAACTTTAAATATAAATTCAAAG
CATATCTAGGGTTGGTTACTGATACTTGGCTTCCACGAATCATAATGGTGCTTCTCTTGATTGTCACTCTTATAAAATTGCAGTCAGGAGGTCCATCTTGGACGGTGCTCTTGGGGAGGA
GGGACAGCTTGACGGCGAACCAAGCAGGAGCGAACACATCGATACCTAGCCCTTTTGGTTCCTTGGCTAACCTCACTTCCCAATTCGCCGCTGTTGGATTGGACACCAATGACCTTGTCA
CTCTTTCC
GGTAAAGAACCACAGACAAAAAGAAGAGCTAAAGTGTATTGTTGGACTTGCATCTGAAGATCCAAAGGATGGTGTCAAAATTTGCATACAAACTCATAGATTTATATGCTAA
ATGATAAGTTTATTAAGGTCGTTTTAAATTAATATATCAAGTAACATCGTAGATCGCAATTATTTTACATTTAACATGACCCACTTACTCAGATGCATCCTAATGAATTTGTCACATTTA
TTTGGTATACAACTTATTTTAAGCATACCTAGGATTGCTCTTCATCGACTTCCATAACTAAGCATTTGCAGATTCTTTGTTCAGCCTCAGCTAACTTTTCGTGCATCTGATCATGAAACA

GGAGCTCACACCTTTGGACGTGCACAATGCAGGACATTCAGCCCTAGGCTCTACAACTTCACCAATGGCGGCCCCGATCCCACCATAAGTCCTTCATACTTGACCACTCTCCAACAACTT
TGCCCACAGAATGGAAGCGGCTCCGTCCTCGCCAACCTCGACCCGACGACCGTGAACACATTCGACAACAACTACTACACCAACCTCCAGAACAACCAAGGGCTTCTTCAGTCCGATCAA
GAGCTGTTCTCAACATCTGGCGCCGCAACGATCTCCATCGTCAACAGCTTCAGCGGCAACCAGAGCGCCTTCTTCCAGAGCTTTGCTCAATCGATGATAAACATGGGAAACATTAGTCCT
CTCACCGGAAGTAGTGGGGAGATCAGATCGAATTGCAGGAAGGTCAACGGGAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCCGTTCTCACGCTCCTTCCTCGCTGATGGGGATAGCGGTTTTCGCCGCGTTGTTGTTTCTCCTCCATCCGTCGAGTGCTCAATTAAGCTCAAACTTTTATGCCACATCATGCCCG
AATGTGTCCAACATCGTCCAAACCGTGATCCAGCAGGCCCTTCAATCCGACCCGCGCATCACCGCCAGCCTCCTCCGTCTCCATTTCCACGATTGCTTTGTTGAC
GGGGTGTGATGGATC
GTTGTTGCTGGACAACAGCGCAAACATTAGCAGTGAGAAAGACGCAGCTCCGAATACAAATTCGACAAGAGGGTTCGATGTGGTGGACAACATCAAATCAGCCATCGAGAGCTCTTGTCC
TGGGACCGTGTCTTGCGCCGACATTCTCGCCCTCGGTGCTCAAGCTTCTGT
ATTGCAGTCAGGAGGTCCATCTTGGACGGTGCTCTTGGGGAGGAGGGACAGCTTGACGGCGAACCAAGC
AGGAGCGAACACATCGATACCTAGCCCTTTTGGTTCCTTGGCTAACCTCACTTCCCAATTCGCCGCTGTTGGATTGGACACCAATGACCTTGTCACTCTTTCC
GGAGCTCACACCTTTGG
ACGTGCACAATGCAGGACATTCAGCCCTAGGCTCTACAACTTCACCAATGGCGGCCCCGATCCCACCATAAGTCCTTCATACTTGACCACTCTCCAACAACTTTGCCCACAGAATGGAAG
CGGCTCCGTCCTCGCCAACCTCGACCCGACGACCGTGAACACATTCGACAACAACTACTACACCAACCTCCAGAACAACCAAGGGCTTCTTCAGTCCGATCAAGAGCTGTTCTCAACATC
TGGCGCCGCAACGATCTCCATCGTCAACAGCTTCAGCGGCAACCAGAGCGCCTTCTTCCAGAGCTTTGCTCAATCGATGATAAACATGGGAAACATTAGTCCTCTCACCGGAAGTAGTGG
GGAGATCAGATCGAATTGCAGGAAGGTCAACGGGAGTTGA

Retrieve as FASTA