Entry information : EcamPrx148 (EcC019238.40)
Entry ID 10399
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2012-03-14 (Qiang Li)
Peroxidase information: EcamPrx148 (EcC019238.40)
Name (synonym) EcamPrx148 (EcC019238.40)
Class Class III peroxidase     [Orthogroup: Prx161]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx148
start..stop
S start..stop
EglPrx148 383 8e-136 1..204 1..204
EguPrx148 377 2e-133 2..204 2..204
EgrPrx148 367 2e-129 1..204 1..204
EguPrx[P]147 347 6e-122 11..204 1..194
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67..285 219 N° 2 375..566 192 N° 3 658..823 166 N° 4 967..1091 125
join(67..285,375..566,658..823,967..1091)


exon

Literature and cross-references EcamPrx148 (EcC019238.40)
Protein sequence: EcamPrx148 (EcC019238.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   233 (207)
PWM (Da):   %s   24466.93 (21791.7)  
PI (pH):   %s   5.68 (6.24) Peptide Signal:   %s   cut: 27 range:27-233
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSSCFVALFTLSCTLLLLMGCSDAQLSPDFYSKSCPDVFTGVKSQVESAVSKEPGMGASLLRLFFHDCFVNGCDGSVLLDNTPTFTGEKNAAPN*NSARGFEVIDDVKSAVEKVCPGVVSCADLLAITAPDSVVLLGGPSWNMKLGRRDARTASQVAANSSLPSPASNLTDLISSFENAGFSTTDLVALSGSHSIGQAKCANSCLHTWPYSVDNTRPYNPKENTGRKRNLN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCATCATCATGTTTTGTGGCCCTTTTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTCTCCCCTGATTTTTATTCAAAATCGTGTCCCGACGTC
TTCACCGGGGTCAAATCCCAGGTGGAATCCGCTGTTAGCAAGGAACCTGGAATGGGAGCCTCCCTCCTCCGCCTGTTCTTCCACGATTGCTTTGTGAAT
GTAAGCTACCTTAAATTGACC
TATCTTTCTTTCATTGTCTTCACACATATCCTAGAAATTAATTTCTTGTCTTTCGTCTATTGCCACAGGGCTGCGATGGATCGGTTCTTCTCGACAACACACCAACGTTCACTGGTGAAA
AGAACGCAGCTCCAAACTGAAACTCTGCCAGAGGATTTGAGGTCATAGACGATGTCAAGTCTGCTGTGGAGAAAGTGTGCCCCGGTGTTGTTTCTTGCGCTGACTTGTTGGCCATCACCG
CTCCTGACTCCGTCGTCTTG
GTAAGCCCTCCCAATCCCTTTAAAAAAATCACTACCCCATACAAGTACTACTCACGAATTTGCTCTAACTAAGATTGTGTAAAATTTGCAGCTTGGAGGG
CCAAGCTGGAACATGAAACTCGGGAGGAGAGATGCAAGAACCGCGAGCCAAGTAGCTGCTAACAGTAGCCTTCCCTCTCCAGCCTCAAACCTTACCGACCTAATATCTAGCTTTGAAAAT
GCTGGCTTCTCCACGACAGACTTGGTGGCTTTATCTG
GTACGTACACTCATAAACACAATCCCGGACGATCGCCGGAGTAATAATGCAAAAAGCATTCTCTTTTATTTTTTGATTGTAAA
TGGAGAAAAAAAGAAAAAGAAAAAAAAAGAGATACTAACTTATCATATCTGTTTTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGCAAATTCCTGTTTACATACGTGGCCTTATT
CAGTGGACAATACGAGACCCTACAACCCTAAAGAAAACACAGGGAGAAAAAGGAACTTGAATGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCATCATCATGTTTTGTGGCCCTTTTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTCTCCCCTGATTTTTATTCAAAATCGTGTCCCGACGTC
TTCACCGGGGTCAAATCCCAGGTGGAATCCGCTGTTAGCAAGGAACCTGGAATGGGAGCCTCCCTCCTCCGCCTGTTCTTCCACGATTGCTTTGTGAAT
GGCTGCGATGGATCGGTTCTT
CTCGACAACACACCAACGTTCACTGGTGAAAAGAACGCAGCTCCAAACTGAAACTCTGCCAGAGGATTTGAGGTCATAGACGATGTCAAGTCTGCTGTGGAGAAAGTGTGCCCCGGTGTT
GTTTCTTGCGCTGACTTGTTGGCCATCACCGCTCCTGACTCCGTCGTCTTG
CTTGGAGGGCCAAGCTGGAACATGAAACTCGGGAGGAGAGATGCAAGAACCGCGAGCCAAGTAGCTGCT
AACAGTAGCCTTCCCTCTCCAGCCTCAAACCTTACCGACCTAATATCTAGCTTTGAAAATGCTGGCTTCTCCACGACAGACTTGGTGGCTTTATCTG
GTTCACATTCGATAGGGCAAGCG
AAATGTGCAAATTCCTGTTTACATACGTGGCCTTATTCAGTGGACAATACGAGACCCTACAACCCTAAAGAAAACACAGGGAGAAAAAGGAACTTGAATGAG

Retrieve as FASTA