Entry information : EcamPrx119 (EcC020708.40)
Entry ID 10403
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx119 (EcC020708.40)
Name (synonym) EcamPrx119 (EcC020708.40)
Class Class III peroxidase    [Orthogroup: Prx081]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx119
start..stop
S start..stop
EgrPrx119 686 0 1..338 1..338
EguPrx119 685 0 1..338 1..338
EglPrx119 682 0 1..338 1..338
EglPrx118 615 0 1..338 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..243 243 N° 2 707..1480 774  
join(1..243,707..1480)


exon

Literature and cross-references EcamPrx119 (EcC020708.40)
Protein sequence: EcamPrx119 (EcC020708.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (312)
PWM (Da):   %s   36315.74 (33638.3)  
PI (pH):   %s   9.65 (9.65) Peptide Signal:   %s   cut: 27 range:27-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVASMFRGLAWAFILVLVDSVASAAATKPCPTSSKFTVRFYKYTCPAAESIIKQTVYEAVAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTPKNPAERDHPANNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSIFKTGGIYYDVPAGRRDGRISRLPEVTQNLPPPNFSAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSFSSRLYAFNTTLAQDPTLDPAFASLLKTKCPPPSNATRADPTVPLDSITPNALDNKYYLQLLKLRGVLATDETLYKSPSTSRMVVSNAVNGAAWRVKFAKAMVKMGSLDVLTGTQGEIRKVCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTTCGATGTTCCGGGGTCTCGCATGGGCTTTTATCCTAGTTCTAGTCGACAGCGTCGCGTCTGCGGCGGCTACGAAGCCGTGCCCGACATCATCCAAGTTCACGGTCAGGTTC
TACAAGTACACCTGTCCGGCTGCGGAGTCTATCATCAAGCAGACTGTGTATGAAGCCGTCGCCAAAAATCCGGGAATGGCGGCCGGACTTCTCCGCCTACATTTCCACGATTGCTTTGTT
AGG
GTACGTGAAGCATCTTTAGCTCCTTTTGACAAGTCCTTTAGTTTATAAGCTCGTTTCACTATACATATACGTGTGCATGGCCGTCCGCAAACGGACTTCATGACACATAATACTTTG
TCAATCACTGTCCATTGAAAGTTACAGAATTGGTCAACGCTTCACGGTTGACACGATTGAATGGAGCGTAAGTGTTTTTTCATGTTAAAAGTTACATACCAACTGCACCGGATCGGGTCA
TCCGTATAGGCCAAAAGTTGGACTTTAACAAGGTCATTGAGGTTGTAGGGTATTCCGTGCGCTTCAAAGATGGCAAGGCCTCTAAACTCATGCCCTTAGATTATAAAATGAAAGTCACAT
AATCAAATACAAGACTTCGTTGAGTAAATTTTACCTGCAAAGTTCTTAAAGTAAGACATTTGGTATGGCATATTGTTTCTCTTTGTAACCATTGAATTTTGATTAGGGTTGCGATGCGTC
GGTGCTGTTGAAATCGACTCCTAAAAACCCGGCGGAAAGAGACCATCCGGCCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGATCAGGCTAAGGCCCGACTCGAGGCTGTGTGTCC
CAAGACGGTCTCGTGCGCCGATATCGTCGCTTTTGCGGCCCGTGACAGCATTTTCAAAACCGGTGGCATATACTATGACGTCCCCGCCGGACGCCGTGACGGCCGCATCTCTCGCCTTCC
CGAAGTGACTCAAAACCTCCCGCCACCAAACTTCAGCGCCCAACAGTTGATCGCTAATTTCGCCAGGAAAGGGCTGTCGGCGGATGAGATGGTGACCCTCTCGGGAGCGCACTCCATCGG
CATCTCGCACTGCTCGTCCTTCTCGTCCCGGCTCTACGCGTTCAACACCACGCTCGCCCAAGATCCTACGTTGGATCCGGCGTTTGCCTCCTTGTTGAAGACCAAATGCCCACCCCCAAG
CAACGCGACACGAGCAGACCCGACGGTGCCGCTCGACAGCATCACGCCCAACGCTCTGGACAACAAGTACTACCTCCAGCTGCTGAAGCTCCGCGGCGTGTTGGCTACGGATGAGACGCT
GTACAAGAGTCCCTCGACTTCCCGGATGGTCGTGAGCAACGCAGTGAACGGCGCTGCCTGGAGGGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGCTCGACGTGCTCACCGGCAC
ACAGGGAGAGATCAGGAAGGTGTGCAGCGTGGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTTCGATGTTCCGGGGTCTCGCATGGGCTTTTATCCTAGTTCTAGTCGACAGCGTCGCGTCTGCGGCGGCTACGAAGCCGTGCCCGACATCATCCAAGTTCACGGTCAGGTTC
TACAAGTACACCTGTCCGGCTGCGGAGTCTATCATCAAGCAGACTGTGTATGAAGCCGTCGCCAAAAATCCGGGAATGGCGGCCGGACTTCTCCGCCTACATTTCCACGATTGCTTTGTT
AGG
GGTTGCGATGCGTCGGTGCTGTTGAAATCGACTCCTAAAAACCCGGCGGAAAGAGACCATCCGGCCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGATCAGGCTAAGGCCCGA
CTCGAGGCTGTGTGTCCCAAGACGGTCTCGTGCGCCGATATCGTCGCTTTTGCGGCCCGTGACAGCATTTTCAAAACCGGTGGCATATACTATGACGTCCCCGCCGGACGCCGTGACGGC
CGCATCTCTCGCCTTCCCGAAGTGACTCAAAACCTCCCGCCACCAAACTTCAGCGCCCAACAGTTGATCGCTAATTTCGCCAGGAAAGGGCTGTCGGCGGATGAGATGGTGACCCTCTCG
GGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCGTCCCGGCTCTACGCGTTCAACACCACGCTCGCCCAAGATCCTACGTTGGATCCGGCGTTTGCCTCCTTGTTGAAGACC
AAATGCCCACCCCCAAGCAACGCGACACGAGCAGACCCGACGGTGCCGCTCGACAGCATCACGCCCAACGCTCTGGACAACAAGTACTACCTCCAGCTGCTGAAGCTCCGCGGCGTGTTG
GCTACGGATGAGACGCTGTACAAGAGTCCCTCGACTTCCCGGATGGTCGTGAGCAACGCAGTGAACGGCGCTGCCTGGAGGGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGCTC
GACGTGCTCACCGGCACACAGGGAGAGATCAGGAAGGTGTGCAGCGTGGTGAACTGA

Retrieve as FASTA