Entry information : EcamPrx188 ( EcC020752.10)
Entry ID 10404
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EcamPrx188 ( EcC020752.10)
Name (synonym) EcamPrx188 ( EcC020752.10)
Class Class III peroxidase    [Orthogroup: Prx137]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx188
start..stop
S start..stop
EgrPrx169 622 0 1..319 1..320
EcamPrx200 595 0 1..319 1..320
EcamPrx[P]169 536 0 1..319 1..339
EglPrx[P]169 530 0 1..319 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 741..929 189 N° 3 1022..1570 549  
join(1..219,741..929,1022..1570)


exon

Literature and cross-references EcamPrx188 ( EcC020752.10)
Protein sequence: EcamPrx188 ( EcC020752.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (293)
PWM (Da):   %s   34187.12 (31399.7)  
PI (pH):   %s   8.2 (7.34) Peptide Signal:   %s   cut: 26 range:26-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNTNRKIYFVFFVCAIALRSALAQLSNQDYYTQRCPRALETIQSAVRSAVANETRMGASLLRLHFHDCFVNGCDASIILDDTVNFIGEKTAFPNVNSVRGFDVIDTIKLKVEKLSPRVVSCANILAIAARDSIVLDGPSWQVQLGRRDSTTASLNDANIDLPAPTLNLSGLVASFSNKGFTAKEMVTLSGSHTISQARCVTFRT*LYNESNISPSFAMSLKPNCPSSGGDNNLSPLDITSPAFFDNAYFSNLVSQEGLLHSDQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa (3' end is missing; stop in frame maybe due to bad sequencing). Close to EcC020752.30 (Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGTCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
CTGGAGACCATCCAATCTGCTGTGAGATCGGCGGTGGCCAACGAGACTCGCATGGGAGCATCCTTGCTCCGACTTCACTTTCACGATTGCTTTGTCAAT
GCAAGTCTCTTCCGCTTTCTC
GCTCAGTTCTATCCTTTTTCCTTCGTGTCCAGTTTCGTGTATGTTTTGCATGTTCTTTTACGTGCAAACTTTTACTTCATTCCCAATCCATATAAGGATTGCTCTTCCTCCGCGTTTATT
TTCGATGGTTCCTCGCATGTCTGCTTAATTCACTCCTGATTGAAAATGGCCAACATTTTGGAGATTCGGATCTTTGAGGAATATTGCAACAAGTGAGCTACGTGGGCCAATGATTCCATT
AAATTAAGAAAGAACACGCATTGAGCTGATCATAGCACACCATTTAGACGACCTGCCAATCTTGTGTCTCTANNNNNNNNNNNNNNNNNNNNCTTATTCTATTCTAACCGATGAATTGTC
TCTCTCTTAACGTTCCTTTCCGGTTGCTTGCAAAAAAATTTATTTTGTTTCCTCATAGGTTCAATATTTAGATCATCCTTTCTAGTTCGTTAGATCTTCTAAACTTAATAAGATGTTATT
TTTTTTTTTTTTTTTGATAGGGATGTGATGCATCCATTATACTAGATGACACTGTGAACTTCATTGGGGAGAAGACAGCGTTTCCCAACGTGAACTCCGTGAGGGGATTCGATGTGATTG
ACACCATCAAGTTAAAAGTGGAGAAACTGAGTCCTCGCGTTGTCTCGTGCGCTAACATCTTGGCCATTGCTGCTAGGGACTCCATCGTC
ATTGTAAGCATTGACACTTGAAATTTCTTTA
AACATACAAAGAAACTATTATTTTCCTAAACTTATGTGGATTCAATTAATTTGATGTTTAGTTGGATGGACCGAGTTGGCAAGTCCAACTGGGAAGAAGAGACTCAACCACAGCAAGCCT
AAATGATGCTAATATCGACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCGCCTCTTTCTCTAACAAAGGCTTTACTGCCAAAGAAATGGTAACGCTATCAGGATCCCACACCAT
AAGCCAAGCTAGGTGCGTGACGTTTCGGACCTGACTCTACAATGAGAGCAATATAAGCCCATCATTCGCCATGTCTTTAAAGCCCAATTGCCCCAGCTCTGGAGGCGACAACAACCTATC
CCCTCTTGACATCACAAGCCCGGCGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGATCAACAATTGTTTAGTGGAGGTTCGACGAATGCTCA
AGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCTTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAG
AAAAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGTCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
CTGGAGACCATCCAATCTGCTGTGAGATCGGCGGTGGCCAACGAGACTCGCATGGGAGCATCCTTGCTCCGACTTCACTTTCACGATTGCTTTGTCAAT
GGATGTGATGCATCCATTATA
CTAGATGACACTGTGAACTTCATTGGGGAGAAGACAGCGTTTCCCAACGTGAACTCCGTGAGGGGATTCGATGTGATTGACACCATCAAGTTAAAAGTGGAGAAACTGAGTCCTCGCGTT
GTCTCGTGCGCTAACATCTTGGCCATTGCTGCTAGGGACTCCATCGTC
TTGGATGGACCGAGTTGGCAAGTCCAACTGGGAAGAAGAGACTCAACCACAGCAAGCCTAAATGATGCTAAT
ATCGACCTCCCAGCTCCAACTCTTAATCTCAGTGGTCTCGTCGCCTCTTTCTCTAACAAAGGCTTTACTGCCAAAGAAATGGTAACGCTATCAGGATCCCACACCATAAGCCAAGCTAGG
TGCGTGACGTTTCGGACCTGACTCTACAATGAGAGCAATATAAGCCCATCATTCGCCATGTCTTTAAAGCCCAATTGCCCCAGCTCTGGAGGCGACAACAACCTATCCCCTCTTGACATC
ACAAGCCCGGCGTTCTTTGACAATGCCTACTTCAGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGATCAACAATTGTTTAGTGGAGGTTCGACGAATGCTCAAGTGGCTGCCTAC
AGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCTTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAAT

Retrieve as FASTA