Entry information : EcamPrx157 (EcC021489.10)
Entry ID 10407
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx157 (EcC021489.10)
Name (synonym) EcamPrx157 (EcC021489.10)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx157
start..stop
S start..stop
EgrPrx157 679 0 1..331 1..331
EglPrx157 678 0 1..331 1..331
EguPrx157 648 0 1..331 1..331
CclPrx35 522 0 1..330 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 597..788 192 N° 3 877..1042 166 N° 4 1397..1806 410
join(1..225,597..788,877..1042,1397..1806)


exon

Literature and cross-references EcamPrx157 (EcC021489.10)
Protein sequence: EcamPrx157 (EcC021489.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (309)
PWM (Da):   %s   36648.48 (34172.3)  
PI (pH):   %s   8.39 (8.37) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARSMTFLILFSILALAPMCYCRRTYGGYLYPQYYDYSCPQAEDIVRSVVAKAVAKEARMAASLLRVHFHDCFVQGCDGSILLDSTGTMPSEKRSNPNRKSARGFEVIEEIKAALEEQCPHTVSCADILALAARDSTVLMGGRSWEVPLGRKDSRGASLTLSNLNIPAPNDTFPILLNKFNRQGLDIIDLVALSGSHTIGNARCTVFRQRLYDQSGDDQQDSRLDQSYASQLRANCPRSGGDQNLFILDNVTPTAFDNSYFKNLLAYRGLLSSDQVLFTSNKESIELVKKYAKDNEVFLQQFAASMVKMGNILPSTGSRGEIRKICRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGGTCTATGACTTTTCTCATTCTCTTCTCAATCCTTGCACTTGCTCCAATGTGTTACTGTCGCAGAACCTATGGCGGTTACCTGTATCCCCAGTATTATGACTATTCATGCCCG
CAAGCTGAGGATATCGTCAGGTCCGTTGTGGCAAAAGCTGTAGCCAAAGAAGCTCGCATGGCTGCTTCCTTGCTACGGGTTCACTTCCACGACTGTTTTGTTCAG
GTCAGTGACCTGTTA
ATTTTTTCAGCTGCACAGTCACGTTTCATGTTAAAATGTACTGGTCAGGTGTACACAGTTGCATACATTTCAGTTGCAGTGCTTTGTGCATCTTTAGTTGCGTACATTATGTGGACACGG
CCGCACATTTACTTGATAGTCAACAGAAGCCGAAGCAAAGGGCTTAAAATGAAGAGATACCATGTTCACAAATGTGCAAACATTATGGGTTGTATTCAACTGAAAAGTGTCCGCGTAATT
TGTGCCAAACACAGTCTCTACTGTATTGGTTTCCCTAAAATAGGACACCGCCTCTGTTATGTTGCAGACAAGAGTTAGTTTTTCATCTCTAAATCCCTTTTTCTGCAAACTTTCAGGGAT
GTGATGGATCGATACTCTTAGACAGCACCGGAACCATGCCCAGTGAGAAAAGGTCTAACCCGAATCGTAAGTCCGCTCGCGGATTCGAAGTCATTGAGGAAATAAAGGCTGCCCTAGAAG
AGCAGTGCCCGCATACTGTGTCCTGTGCTGATATACTTGCTTTAGCTGCCAGAGACTCCACTGTTCTT
GTGAGTGATTTGCTTAATTAGGCTTTCCTAAACTATAAAGTGAAGTCATGGG
TTGAATCGTTAATAACTTACATTTTGTTCTCTTCAGATGGGTGGACGTAGCTGGGAGGTTCCTCTAGGAAGAAAGGACTCGAGGGGTGCAAGTTTAACTCTTTCTAACCTCAACATCCCT
GCACCAAATGACACTTTCCCGATCCTCCTGAACAAATTCAATCGCCAGGGGCTCGATATTATTGATCTCGTCGCATTATCAG
GTAAGATACGACTCTAACCTATAACGATCTACTCTTGC
CTCTGGGTAGAATCTTGAAGCCTCTTCTATTTGACGTTTCCTACAAAAGGAAAACTTCCTATATGATGCAGCAATTTTCTTGTTGACCGGGTTGAATGAATTCAGGTTTTTCAAAACAAA
AGAGCTCCTAATGCATTATCATTGCTTCGTTCAAATAACGCTTAATCGAGAGAGAGAGAGAGAGAGAGAGAGTGGGTTTCATGAAATCACTGGCAAATTTCATATGATAATCTGCTAGTG
TCAGCAACAGTTTAAGCATTCAGAGTCATGTAATGCACGTGTGGGGGTCTGGTACATGATTTTTCTCCCTGTACAGGAAGCCACACCATTGGCAATGCAAGATGCACCGTGTTTAGACAA
AGGCTCTACGACCAGTCAGGGGACGATCAACAGGACTCCAGACTAGACCAGTCATATGCTTCCCAACTCCGTGCCAATTGCCCGAGATCGGGCGGTGATCAGAACCTGTTCATCTTGGAC
AATGTCACTCCAACTGCGTTCGATAACAGCTACTTCAAGAATTTGCTGGCTTACAGGGGCCTGCTGAGCTCTGACCAAGTGCTCTTCACCAGTAACAAGGAATCAATTGAGTTGGTGAAG
AAATACGCAAAGGACAATGAAGTCTTCTTGCAACAATTTGCAGCTTCAATGGTCAAGATGGGTAATATCTTGCCATCGACAGGATCGAGGGGTGAGATCAGGAAGATCTGCAGGAAGATC
AACAGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCGGTCTATGACTTTTCTCATTCTCTTCTCAATCCTTGCACTTGCTCCAATGTGTTACTGTCGCAGAACCTATGGCGGTTACCTGTATCCCCAGTATTATGACTATTCATGCCCG
CAAGCTGAGGATATCGTCAGGTCCGTTGTGGCAAAAGCTGTAGCCAAAGAAGCTCGCATGGCTGCTTCCTTGCTACGGGTTCACTTCCACGACTGTTTTGTTCAG
GGATGTGATGGATCG
ATACTCTTAGACAGCACCGGAACCATGCCCAGTGAGAAAAGGTCTAACCCGAATCGTAAGTCCGCTCGCGGATTCGAAGTCATTGAGGAAATAAAGGCTGCCCTAGAAGAGCAGTGCCCG
CATACTGTGTCCTGTGCTGATATACTTGCTTTAGCTGCCAGAGACTCCACTGTTCTT
ATGGGTGGACGTAGCTGGGAGGTTCCTCTAGGAAGAAAGGACTCGAGGGGTGCAAGTTTAACT
CTTTCTAACCTCAACATCCCTGCACCAAATGACACTTTCCCGATCCTCCTGAACAAATTCAATCGCCAGGGGCTCGATATTATTGATCTCGTCGCATTATCAG
GAAGCCACACCATTGGC
AATGCAAGATGCACCGTGTTTAGACAAAGGCTCTACGACCAGTCAGGGGACGATCAACAGGACTCCAGACTAGACCAGTCATATGCTTCCCAACTCCGTGCCAATTGCCCGAGATCGGGC
GGTGATCAGAACCTGTTCATCTTGGACAATGTCACTCCAACTGCGTTCGATAACAGCTACTTCAAGAATTTGCTGGCTTACAGGGGCCTGCTGAGCTCTGACCAAGTGCTCTTCACCAGT
AACAAGGAATCAATTGAGTTGGTGAAGAAATACGCAAAGGACAATGAAGTCTTCTTGCAACAATTTGCAGCTTCAATGGTCAAGATGGGTAATATCTTGCCATCGACAGGATCGAGGGGT
GAGATCAGGAAGATCTGCAGGAAGATCAACAGT

Retrieve as FASTA