Entry information : EcamPrx58 (EcC021894.20)
Entry ID 10409
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx58 (EcC021894.20)
Name (synonym) EcamPrx58 (EcC021894.20)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx58
start..stop
S start..stop
EcamPrx176 607 0 1..328 1..325
EgrPrx176 543 0 13..304 1..289
MePrx127 478 7e-172 5..328 4..324
CmicPrx01 478 2e-171 1..328 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..216 216 N° 2 695..886 192 N° 3 1415..1580 166 N° 4 2908..3317 410
join(1..216,695..886,1415..1580,2908..3317)


exon

Literature and cross-references EcamPrx58 (EcC021894.20)
Protein sequence: EcamPrx58 (EcC021894.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (304)
PWM (Da):   %s   35654.97 (33196.7)  
PI (pH):   %s   8.4 (8.73) Peptide Signal:   %s   cut: 25 range:25-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSNVSLVSVIAIVVFFGHIGDSEGGDLRKNFYKSACPLAEEIVKNVTWKHVASNSALPAKFLRMHFHDCFVRGCDGSILLDSTGNNKAEKAAVPNQSLTGFDVIDKIKEKLEETCPGVVSCADILALAARDSVSFQFKKSMWEVLTGRRDGRISRKSEVLSNIPNPFSNFVSLKQSFANKGLNLHDLVVLSGGHTIGVGHCNFFSKRLYNFTGKGGKGDQDPSLNPTYASQLKAQCKTLSDTTTTVAMDPGSPLAFDNHYYTALNQNQGLFQSDASLLSNQESSKIVNELLDQDSFFTKFGQSMKRMGAVQVLTGSDGEIRKKCNVI

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAATGTGAGCTTAGTGTCGGTAATCGCTATAGTTGTCTTCTTTGGGCACATAGGGGATTCGGAAGGAGGGGACTTGAGGAAGAATTTCTACAAGAGCGCATGTCCTCTCGCTGAG
GAAATAGTGAAGAATGTCACGTGGAAGCATGTCGCTAGCAACTCAGCTTTGCCCGCCAAGTTCTTGAGAATGCATTTCCATGACTGCTTCGTTAGG
GTACGTACGTATGTATACACTATG
TCATCCATGCATTCGAATAGATTAAACCCGACACCACGCCTATGCTGGGACTCTCATTAGGCAATCAGCAATCTCTCCATCTAAAACGAAGATGATGATGACATTATACGCACTTGACTT
GCATGAGTAAAACTAATTATATGAGACTGTAGTATGATCCGGTGAAACTTACCGTCATCCAAGGATGCACGGGCGTGTGCACGGGCCGGAGAACTCAACCTTGTGCATGAATTACCTTCT
TTTGATCTAGTGTCCTACACGGTTGCTTGAGTCTTGTGTATGAAGTACTCAATTTTTGCGCGTACACATGCTATTTCTTGATTGTACTGAGAAGAAGAATCATTTCATTGTTTCTTGTGC
TAAAAAAATCGATGCTGACGTGCATGATTGTAGAAGGAGAGTTTCGTGTGGTAATATTTCATCGGTGTTTGATTGCATCGTTTCACGTGTGCAGGGTTGTGACGGCTCAATTTTGCTAGA
CTCGACGGGGAACAACAAGGCGGAGAAGGCGGCGGTTCCGAACCAATCGCTAACTGGGTTTGATGTGATAGACAAGATCAAGGAGAAGCTAGAGGAAACATGCCCCGGCGTCGTCTCTTG
TGCCGACATCCTGGCTTTAGCTGCTAGAGACTCGGTCTCTTTCCAA
GTAAGACTTTTTGGAGTGATGAAAACTCTTGAACAATTCATTGGTATTCTTTTGAGTTTGTTTCAACACTTTTG
AAAACTTCATGAGTTAGAACTTTAATATCCTTAGCAACAATCCTCACACTTGCTTTTGAAAAAATTATTGTGGAAAAATCCCGTTGGACCATTTGATGGCGACAGTAGACTATCAATCAA
AAGCTTATCTATCTTCCTTTGATATTATTTTCAACCCCACACATACACCGACCCTAATCATATTCCGATTCGTGATCAACCCATAGATAATAAAATATATACATTGGCCATAATCATTAT
CCAAAATTAGAGGATATCTTTTTCCTCAAAATTAAAAGTTTTCTCTTACTTCTGGCTGTTGAAAACTCTCACAAATAATGTGCAAACCACTCAAAACAGAGTCGATCCCCATATTGGTCG
GCAGCTTCTATATAGTGGATACATATCATGATTTACATTAATTTGACATTTCAGTGGATCTCACATATGGCACCAATTAATTGTGATTTTGCAGTTCAAGAAGTCAATGTGGGAGGTGTT
GACTGGAAGAAGAGACGGGAGAATCTCACGGAAATCAGAAGTACTTTCAAATATCCCTAACCCATTCTCCAACTTCGTGTCTCTCAAGCAATCCTTTGCCAACAAGGGCCTCAATCTTCA
CGACCTTGTTGTCTTATCAG
GTAAATTAAATATAAAAAGAATTTCACATTTTATATGGTCAAAATTAGCCAAGTGCTCCTGGGTAGGTTGTCCTAATGTCTAGTGAGTCAATTTTCCTTT
ACAGGTCATTTATTTTTGCGCGTGTGAATATTTTCGTAAGAATGCACATGCATTATACCGGATTATCTCTGAAAAATATTTAATGAAACACCCTTTTTCTCGATTCTGAAAAGGGAAACC
AATTCGTCAATGTGATGGGTAAAATGGCCCCACACAGTGAATTTATGCACTTTCAAGCGAATCTCATTTCCCAAAACAAAGAAATGTTGCAACTTGGACCCCACTTTCTATTTTCTACGG
GATGGGCAACCAGAACACAATATCCGTGGACGAGCAAGATTCGAAATTTCATATTTATGTAGATTCTATATAGTTTTTGGTCTTACAATGAGAGAAACATAACTCGATGATATTATTCAA
GCAAAAAAAAAAAAAAAAAACACTCCATGGAAAGTTCCATAGTAATTTTAGGTGGTCATTGCAAAAAACAAGAAAAAAAAAGAATGATAATATCTATGAATTGATAAATGCGAAAAGTAA
ATATCCGGTCATGAAGGATATAAATCATGGATTCAATTCTCCTACCATTTTCTGATTACGAAACGACTAAGCTCTTAAAGAAGTTTATTAAATTTCTTATTTACTGTCATCACATGCAAG
TAAATGGGAATTGAACGTCGAATTTAATGGTTGTTTATCAAAAAAATATTTCTTGAAACAAATTTGCTCAAAATATTTTTTTCGGTTTTGTTTTTTATATGCAGTTCCTTTTACCATATT
TGGATTGATTAAAAAAAATATTACAAGAAAAGTCGAAGCAGATGTGGTAAAAGATAGATATCAAACGTAAACAAAAGAAAATTCAACTTTAAATGGAATACCATAAGTTGATGAAACGAA
TATTGTTTTATATTTGTGATTATCTGAATTACATTCAATAATTGTTGTAGGTTTCATTTATTTTTTTCCTCCCTTTTAACTTACATTAGACAATGTTTATATTTTAAGGGAATCCCACAT
GGTGAGTAACCATGGGCTTATCTTCTCAAATTTCCCTTACCAAATCTCCTATAGGAATTTTATAAAGTTTATGGCTTGTATATTTTACATTTTATTATCTAATGTTTTAGAAACGACCAA
AATATATTTTTAATATTAAATGGAAATATCATAAGTGACATATACACACGCACACACACTTGAACAAAGTAATCACTAATCAGAATAAGAAGAGAAGTTAAATTAATTCACTAATTAATT
AAGTATACTACATATCTGGGCCATCAGGTGGCCACACAATTGGGGTCGGGCACTGCAACTTCTTCAGCAAGAGGCTCTACAACTTCACCGGCAAAGGCGGCAAGGGCGACCAAGACCCTT
CCCTGAACCCGACCTATGCCTCTCAACTGAAAGCTCAGTGCAAGACGCTCTCCGATACCACCACCACCGTCGCGATGGACCCTGGAAGCCCCCTCGCCTTCGACAACCACTACTACACGG
CCTTGAACCAAAACCAAGGCCTCTTCCAGTCCGACGCCTCGCTCCTGTCCAACCAGGAGTCGAGCAAGATCGTGAACGAGTTGCTGGACCAGGACAGCTTCTTCACCAAGTTTGGCCAGT
CGATGAAGCGGATGGGCGCCGTCCAAGTGCTCACGGGGAGCGACGGTGAGATCCGGAAGAAATGTAATGTGATTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAATGTGAGCTTAGTGTCGGTAATCGCTATAGTTGTCTTCTTTGGGCACATAGGGGATTCGGAAGGAGGGGACTTGAGGAAGAATTTCTACAAGAGCGCATGTCCTCTCGCTGAG
GAAATAGTGAAGAATGTCACGTGGAAGCATGTCGCTAGCAACTCAGCTTTGCCCGCCAAGTTCTTGAGAATGCATTTCCATGACTGCTTCGTTAGG
GGTTGTGACGGCTCAATTTTGCTA
GACTCGACGGGGAACAACAAGGCGGAGAAGGCGGCGGTTCCGAACCAATCGCTAACTGGGTTTGATGTGATAGACAAGATCAAGGAGAAGCTAGAGGAAACATGCCCCGGCGTCGTCTCT
TGTGCCGACATCCTGGCTTTAGCTGCTAGAGACTCGGTCTCTTTCCAA
TTCAAGAAGTCAATGTGGGAGGTGTTGACTGGAAGAAGAGACGGGAGAATCTCACGGAAATCAGAAGTACTT
TCAAATATCCCTAACCCATTCTCCAACTTCGTGTCTCTCAAGCAATCCTTTGCCAACAAGGGCCTCAATCTTCACGACCTTGTTGTCTTATCAG
GTGGCCACACAATTGGGGTCGGGCAC
TGCAACTTCTTCAGCAAGAGGCTCTACAACTTCACCGGCAAAGGCGGCAAGGGCGACCAAGACCCTTCCCTGAACCCGACCTATGCCTCTCAACTGAAAGCTCAGTGCAAGACGCTCTCC
GATACCACCACCACCGTCGCGATGGACCCTGGAAGCCCCCTCGCCTTCGACAACCACTACTACACGGCCTTGAACCAAAACCAAGGCCTCTTCCAGTCCGACGCCTCGCTCCTGTCCAAC
CAGGAGTCGAGCAAGATCGTGAACGAGTTGCTGGACCAGGACAGCTTCTTCACCAAGTTTGGCCAGTCGATGAAGCGGATGGGCGCCGTCCAAGTGCTCACGGGGAGCGACGGTGAGATC
CGGAAGAAATGTAATGTGATTAAT

Retrieve as FASTA