Entry information : EcamPrx08 (EcC022468.20)
Entry ID 10410
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: EcamPrx08 (EcC022468.20)
Name (synonym) EcamPrx08 (EcC022468.20)
Class Class III peroxidase     [Orthogroup: Prx092]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx08
start..stop
S start..stop
EguPrx08 382 5e-136 1..187 1..187
EgrPrx08 380 4e-135 1..187 1..187
EguPrx09 365 3e-129 9..187 1..179
EglPrx08 352 3e-124 1..187 1..188
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..249 249 N° 2 414..599 186 N° 3 715..840 126  
join(1..249,414..599,715..840)


exon

Literature and cross-references EcamPrx08 (EcC022468.20)
Protein sequence: EcamPrx08 (EcC022468.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   187 (165)
PWM (Da):   %s   20408.45 (17943.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.19 (7.24) Peptide Signal:   %s   cut: 23 range:23-187
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWWLLLLLALVVLVSSSAMLRVEAAVGIEPPQKLQWHYYRNSCRNAERYVTSQVEFYWKRDKSLAPKLIRMLYADCFVTGCDASILLDGPYSEKTAPQSAGFLGFPMVVIDKIKQILEERCPGVVSCADILNFAARDAAHLAGGPSYPVLAGRRDGMSSSAASVDLPLGAALWGSALAYFESR

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (3' end is missing due to NNNNN). containing motif yadc.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTTGTTGCTGTTGGCGCTCGTTGTGTTGGTAAGCTCGAGTGCCATGCTGCGTGTTGAGGCGGCGGTGGGGATTGAGCCACCGCAGAAGCTGCAGTGG
CATTACTACCGGAACTCATGCCGCAACGCCGAGAGGTACGTGACGAGCCAGGTCGAGTTCTACTGGAAGCGGGACAAGAGCCTCGCTCCCAAGCTCATCCGAATGCTCTACGCCGACTGC
TTCGTCACG
GTACGGATCTGTCTGTTCTTATCCTCTCTTGAACGATCTTTCAGTCTGCATCGCTTCAATATCGAGTTTCCATCGCCTCTCTAAGCACACAATATCCTCTCACCCAATGTT
TTATGCTCTCGAAACGGGCTTTCTGACGTACCGATCTTTTGTGTATAAAACAGGGGTGCGATGCATCAATTCTATTGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAGCGCAGGGT
TTCTAGGGTTTCCGATGGTGGTGATAGACAAGATCAAGCAAATCCTGGAAGAACGCTGTCCAGGAGTCGTCTCTTGTGCCGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
G
TATGTGCCTGGTTTGCACTTCTCTCTTTTGGCTTGAAAAAGTTGTTTTCGCTTGAGTTTATAACGTTAAATGTGGAAAATAAGAAATACTGATACAATGATAATGTTGTCATAGGCGGGA
GGGCCATCGTACCCCGTTCTGGCAGGGAGGAGGGACGGGATGTCGTCCTCTGCGGCATCGGTGGACCTCCCATTGGGGGCCGCCCTTTGGGGATCGGCGCTTGCTTACTTCGAATCAAGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTTGTTGCTGTTGGCGCTCGTTGTGTTGGTAAGCTCGAGTGCCATGCTGCGTGTTGAGGCGGCGGTGGGGATTGAGCCACCGCAGAAGCTGCAGTGG
CATTACTACCGGAACTCATGCCGCAACGCCGAGAGGTACGTGACGAGCCAGGTCGAGTTCTACTGGAAGCGGGACAAGAGCCTCGCTCCCAAGCTCATCCGAATGCTCTACGCCGACTGC
TTCGTCACG
GGGTGCGATGCATCAATTCTATTGGACGGGCCATATTCAGAGAAAACAGCACCGCAAAGCGCAGGGTTTCTAGGGTTTCCGATGGTGGTGATAGACAAGATCAAGCAAATC
CTGGAAGAACGCTGTCCAGGAGTCGTCTCTTGTGCCGACATTCTCAACTTTGCCGCTAGAGATGCTGCTCACTTG
GCGGGAGGGCCATCGTACCCCGTTCTGGCAGGGAGGAGGGACGGG
ATGTCGTCCTCTGCGGCATCGGTGGACCTCCCATTGGGGGCCGCCCTTTGGGGATCGGCGCTTGCTTACTTCGAATCAAGA

Retrieve as FASTA