Entry information : EcamPrx45 (EcC022949.30)
Entry ID 10411
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx45 (EcC022949.30)
Name (synonym) EcamPrx45 (EcC022949.30)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx45
start..stop
S start..stop
EgrPrx45 659 0 1..318 1..318
EglPrx45 659 0 1..318 1..318
EguPrx45 650 0 1..318 1..318
EgrPrx43 627 0 1..318 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 811..1002 192 N° 3 1097..1259 163 N° 4 1566..1960 395
join(1..204,811..1002,1097..1259,1566..1960)


exon

Literature and cross-references EcamPrx45 (EcC022949.30)
Protein sequence: EcamPrx45 (EcC022949.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (297)
PWM (Da):   %s   34555.31 (32270.0)  
PI (pH):   %s   8.48 (8.28) Peptide Signal:   %s   cut: 22 range:22-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIDSTLSNTAEKDSPANNPSLRGFEVIDSAKARLETMCKGVVSCADILAFAARDSVEMTGGFGYNVPAGRRDGRVSLASETINLPLPSFNVNQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQRCPQNNDSTLVVPMDPPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARNPFIWKKIFAAAMVKMGKIGVLTGSAGEIRANC

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTATCCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCACCAAGGTCAACTAAAAGCGTCGACTAATTTTCTTTCCTTTTTCCTTTGGTTGTATTTTTGTATGCAGAATAATGTGTCAACTAAGAGTTCA
TTAATTCATTGCAATTTACGCCACTCACATGCCATACCCACGTGCCGGTCTCATATGTAGAACATGAATTGACTACTACAAGCTTTTATGTCAATGAAGTATCTTTCGATTAATTTAACG
GGATTGTCATGACCTAATTAATAGATATGATACGTCTACTAATTATATTGCACATTCGAATTGGCATATGATACATACATTTATTAAAAGTTAATTGCTTAACTAGATGTGCCTAAATGC
ATTTAACAAGTTTAGATATTTCCGTTGTGTCTGATGTGTTCATTATTCATCTACCGCAGCTGTCTCATTAATAATGCTCCATGCTGTAAATCTTGTTTAAATATGCTCCTTCTAAACTCA
ATGACCCTCACAGAAGTACCTTAGCTCTGTTTCGGGAATGGATTTCATTTGTGAGTTTTAAGAAACATCTCGTGCTTTGATCCATCTTAGGGTTGTGAAGGTTCCGTGCTCATCGACTCC
ACTCTGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGT
GCTGACATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATG
GTAATCCCGCAAACCCCTTACTCTGTATATTTACCAACTTGAGCATAAGTTCATCATACTAATAAACATGAGGCGTTC
TGTTTTCTTTTTGTAGACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGCAGAGTCTCTTTAGCTTCAGAGACTATAAACTTACCTCTCCCGTCTTTCAATGTCAATCA
ACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTAGAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGATAAAAAAT
AGAACATCAAGATTATGTAGGAAAGAGTAACATTAGAGGAAAAAAATGCTCACAGGGACGAATATTAAGGAAAAAATCATACATGATACTATTCTCTTTTTGAAAGTGGGGTCCTAGATT
TCTGTAATACTTGGCCCATTATGTGTTGTAGGCAACTTACATTCTTGACTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTTACATTAAAAAAAAAAAAAACTCGCTTCATGCGTGT
CACAGGAGCGCATACAATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAA
GCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATGGACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATC
AGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACTCAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGT
CTTGACAGGAAGTGCCGGGGAGATCCGAGCGAATTGCAGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGTTGTGAAGGTTCCGTGCTCATCGACTCCACTCTG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAACTATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCTAGAGATAGTGTGGAGATG
ACGGGAGGCTTTGGGTACAATGTTCCTGCAGGAAGAAGAGATGGCAGAGTCTCTTTAGCTTCAGAGACTATAAACTTACCTCTC
CCGTCTTTCAATGTCAATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACAATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACGGTGTCCACAAAACAATGATTCGACCCTAGTTGTTCCAATG
GACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTTACT
CAAAATGCAAGAAATCCATTCATTTGGAAGAAAATTTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACAGGAAGTGCCGGGGAGATCCGAGCGAATTGCAGG

Retrieve as FASTA