Entry information : EcamPrx43 (EcC027461.40)
Entry ID 10417
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx43 (EcC027461.40)
Name (synonym) EcamPrx43 (EcC027461.40)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx43
start..stop
S start..stop
EgrPrx43 663 0 1..322 1..322
EguPrx171-2 647 0 1..322 1..322
EglPrx43 630 0 1..322 1..322
EgrPrx45 630 0 1..322 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 808..999 192 N° 3 1095..1257 163 N° 4 1564..1973 410
join(1..204,808..999,1095..1257,1564..1973)


exon

Literature and cross-references EcamPrx43 (EcC027461.40)
Protein sequence: EcamPrx43 (EcC027461.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (301)
PWM (Da):   %s   34833.31 (32548.0)  
PI (pH):   %s   7.62 (6.88) Peptide Signal:   %s   cut: 22 range:22-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKLLVCIALVLVSLSRCVESQLQVGFYKDSCRLAEFIVKDEVRKAFIKDKGLAAGLVRMHFHDCFVRGCEGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEDMCKGVVSCADILAFAARDSVEMAGGFGYDVPAGRRDGRVSLASETTNLPPPSFNVDQLTQLFANKGFTQEEMVTLSGAHTIGRSHCTSFNNRLYSFNTTVNQDPSLDPTYASMLKQQCPQGNDPTLVVPMDPPSPNMMDTSYYQGILANRGLFTSDQTLLTNSATANQVTQNARIPSIWKSNFAAAMVKMGKIGVLTGSTGEIRANCRVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GTGAGTGAAAACCAATGACACTAACCCATCTTTTGT
TGTAGCTCTAATTGCAATTAATGTTTTCATCAAGGTCAACTAAAAGCGTCGACTAATTTCCTTTCCTTTTTTCCTTTGGTTGCATTTTTGTATGCAGAATAATGTGTCGAGTAAGAGTTC
ATTAATTCATTGCAATTTACGCCACTCACATGCTATATGCACGTGCGGGCCTCATATGTAGAACATGAATTGACTACTACAAGCTTTTATGTCGACGAAGTATCTTTCGATTAATTTAAC
GGAACTATCATGACCTAATTAATAGATATGATACGTCTACTAATTATATTGCACATTCGAATTGGAATATGATACATTTATTCAAAGTTAATTGCTTAACTATATGTGCCTAAATGCATT
TAACAAGTTTAGAGATTTCAATTGTATCTGATATGTTCATTATTCATCTACCAAAGCTGTCTCATTAATCATGCGCCATGCTGTAAATCTTGTTTAATTATGCTCCTCCTAAACTCAATG
ACCCTCACAGAAGTACCTTAGCTCTGTTTCAGGAATGGATTTCATTTGTGAGTTTTAAGAAACATTGCGTGCTTTGATCCATCTTAGGGTTGTGAAGGTTCCGTGCTCATTGACTCCACT
CCGTCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAGATATGTGCAAAGGAGTTGTTTCCTGTGCT
GACATACTAGCCTTTGCAGCAAGAGATAGTGTGGAGATG
GTAATCCCTCAAACCCCTTAACTCTGTATATTTACCAACTTGAGCATAAGTTCATCATACTAATAAACATGAGGCGTTCTG
TTTTCTTTTTGTAGGCGGGAGGCTTTGGGTACGATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTTCAGAGACTACAAACTTACCTCCCCCGTCTTTCAATGTCGATCAAC
TCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GTAACTCTTCACTTAGAGCAGCAATCTATGAAATGTGGCTATTTAAGTCCAGCTAAAGAATAG
AACATCAAGATTATGTAGGAAAAAGCAACATTCGAGGAAAAAAATGCTCACAGGGACGAATATAAAGATAAAAATCATACATGATACTATTCTCTTTTTGAAACTGCGGTTCTAGATTTC
TGTAACACTTGGCCCATTATGTGTTGTAGGCAACTTACATTCTTGACTCCTCCCCAATTTCATAATCAGAAAAAGGAATATTTACATTAAAAAAAAAAAAAACTTGCTTCATGCGTGTCA
CAGGAGCGCATACGATCGGTCGGTCTCACTGCACTTCCTTCAACAATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGC
AACAGTGTCCACAAGGCAATGATCCGACCCTAGTTGTTCCAATGGACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAG
ACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTCACTCAAAATGCAAGAATTCCATCCATTTGGAAGAGTAATTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCT
TGACTGGAAGTACCGGGGAGATTCGAGCGAATTGCAGGGTCATCAATAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAGCTTCTTGTATGTATCGCTTTGGTCCTGGTCTCACTGTCTCGATGCGTCGAGTCTCAGCTTCAAGTTGGGTTCTATAAGGACTCGTGCAGGTTGGCCGAGTTCATCGTTAAG
GATGAGGTCAGAAAAGCTTTCATCAAGGACAAGGGTTTGGCTGCTGGCCTTGTGAGGATGCACTTTCATGACTGCTTTGTTAGG
GGTTGTGAAGGTTCCGTGCTCATTGACTCCACTCCG
TCAAACACAGCCGAAAAGGATTCTCCAGCCAACAATCCTAGTCTGAGAGGATTCGAAGTAATTGACAGTGCCAAGGCTAGGCTCGAAGATATGTGCAAAGGAGTTGTTTCCTGTGCTGAC
ATACTAGCCTTTGCAGCAAGAGATAGTGTGGAGATG
GCGGGAGGCTTTGGGTACGATGTTCCTGCAGGAAGAAGAGATGGTAGAGTCTCTTTAGCTTCAGAGACTACAAACTTACCTCCC
CCGTCTTTCAATGTCGATCAACTCACACAATTGTTTGCCAACAAGGGTTTCACTCAAGAAGAAATGGTCACACTCTCCG
GAGCGCATACGATCGGTCGGTCTCACTGCACTTCCTTCAAC
AATAGACTGTACAGCTTCAATACAACTGTGAACCAGGACCCAAGCTTGGACCCTACATATGCATCCATGTTGAAGCAACAGTGTCCACAAGGCAATGATCCGACCCTAGTTGTTCCAATG
GACCCCCCTAGCCCGAACATGATGGATACAAGCTATTATCAGGGCATACTTGCGAATCGAGGCTTGTTCACATCAGACCAGACACTCCTCACAAACTCTGCAACTGCAAACCAAGTCACT
CAAAATGCAAGAATTCCATCCATTTGGAAGAGTAATTTTGCCGCTGCAATGGTGAAGATGGGTAAAATCGGTGTCTTGACTGGAAGTACCGGGGAGATTCGAGCGAATTGCAGGGTCATC
AATAGCTAA

Retrieve as FASTA