Entry information : OsPrx32
Entry ID 1042
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx32
Name OsPrx32
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx32
start..stop
S start..stop
ZmPrx136 484 4e-174 28..322 29..328
SiPrx75 467 3e-167 32..322 29..322
SbPrx82 458 8e-164 28..322 31..328
BdiPrx114 429 3e-152 29..322 35..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35894170..35894397 228 N° 2 35894475..35894663 189 N° 3 35894768..35895319 552  
join(35894170..35894397,35894475..35894663,35894768..35895319)


exon

Literature and cross-references OsPrx32
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1R1
DNA ref. GenBank:   NC_008395.1 (35894170..35895316)
Protein sequence: OsPrx32
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (292)
PWM (Da):   %s   33926.96 (30815.4) Transmb domain:   %s   o10-32i
PI (pH):   %s   8.22 (8.58) Peptide Signal:   %s   cut: 31 range:31-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSQSHLDLVQLLIVVVMTMTMLVGGGEALSLDYYAKSCPKAEAAVAAAVKQAMAKDRTVPAGLLRLHFHDCFVRGCDGSVLLDSSGNMSAEKDGPPNASLHAFYVIDNAKAAVEALCPGVVSCADILALAARDAVAMSGGPSWQVPVGRRDGRVSLASETTTALPGPTASFDQLKQAFHGRGMSTKDLVVLSGGHTLGFAHCSSFQNRIQPQGVDPALHPSFAATLRRSCPPNNTARSAGSSLDPTSSAFDNFYYRMLLSGRGLLSSDEALLTHPKTRAQVTLYAASQPAFFRDFVDSMLRMSSLNNVAGEVRANCRRVN*

Retrieve as FASTA  
Remarks chromosome 2. 4 ESTs. Rice cDNA EST clone
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGTCCCAGTCCCATCTGGATCTGGTACAGCTGCTAATCGTTGTGGTGATGACTATGACGATGCTGGTGGGTGGCGGCGAGGCGCTGAGCCTGGACTACTACGCCAAGAGCTGC
CCCAAGGCGGAGGCGGCGGTGGCGGCGGCGGTGAAGCAGGCCATGGCCAAAGACCGCACGGTGCCGGCCGGCCTGCTCCGCCTGCATTTCCACGACTGCTTCGTCAGG
GTAACTAGCTAG
CTACTCTATCGAATTCGAATATATATATATTAACATCAATGAAGGAAGCTGCTAGCTAGCTGCAGGGGTGCGACGGTTCCGTGCTTTTGGACTCGTCGGGGAACATGTCGGCGGAGAAGG
ACGGCCCACCCAACGCGTCGCTGCACGCCTTCTACGTCATCGACAACGCCAAGGCCGCCGTCGAAGCCCTCTGCCCCGGCGTCGTCTCCTGCGCTGACATCCTCGCGCTGGCCGCCAGGG
ACGCAGTCGCCATG
GTAATCCGGCCGGCCCTCAATCAAATTAAGTAGTAAATACAGGAGTATATCAATATATAGCTAGATGAGATGGAGTACTAAACGTACGTACGTACTGCATGCAGTC
CGGTGGTCCTTCTTGGCAAGTGCCGGTGGGTCGTCGTGACGGGCGCGTGTCGCTGGCGAGCGAGACGACGACGGCGCTACCGGGGCCGACGGCGAGCTTCGACCAGCTGAAGCAGGCGTT
CCACGGGCGCGGGATGTCGACCAAGGACCTGGTGGTGCTGTCGGGGGGTCACACGCTTGGCTTCGCACACTGCTCCTCCTTCCAGAACCGCATCCAGCCGCAGGGCGTCGACCCCGCGCT
TCACCCCTCCTTCGCCGCCACCCTCCGCCGCTCCTGCCCACCCAACAACACCGCCAGGTCTGCCGGCTCCTCCCTCGACCCCACCTCCTCCGCCTTCGACAACTTCTACTATCGGATGCT
GCTCTCCGGCCGTGGCCTTCTCTCCTCCGACGAGGCGCTGCTCACCCACCCCAAGACGCGCGCCCAGGTCACGCTCTACGCCGCGTCGCAGCCCGCCTTCTTCCGTGACTTCGTCGACTC
CATGCTACGGATGAGCTCCCTCAACAACGTCGCCGGCGAGGTCCGAGCCAACTGCAGGCGCGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGTCCCAGTCCCATCTGGATCTGGTACAGCTGCTAATCGTTGTGGTGATGACTATGACGATGCTGGTGGGTGGCGGCGAGGCGCTGAGCCTGGACTACTACGCCAAGAGCTGC
CCCAAGGCGGAGGCGGCGGTGGCGGCGGCGGTGAAGCAGGCCATGGCCAAAGACCGCACGGTGCCGGCCGGCCTGCTCCGCCTGCATTTCCACGACTGCTTCGTCAGG
GGGTGCGACGGT
TCCGTGCTTTTGGACTCGTCGGGGAACATGTCGGCGGAGAAGGACGGCCCACCCAACGCGTCGCTGCACGCCTTCTACGTCATCGACAACGCCAAGGCCGCCGTCGAAGCCCTCTGCCCC
GGCGTCGTCTCCTGCGCTGACATCCTCGCGCTGGCCGCCAGGGACGCAGTCGCCATG
TCCGGTGGTCCTTCTTGGCAAGTGCCGGTGGGTCGTCGTGACGGGCGCGTGTCGCTGGCGAGC
GAGACGACGACGGCGCTACCGGGGCCGACGGCGAGCTTCGACCAGCTGAAGCAGGCGTTCCACGGGCGCGGGATGTCGACCAAGGACCTGGTGGTGCTGTCGGGGGGTCACACGCTTGGC
TTCGCACACTGCTCCTCCTTCCAGAACCGCATCCAGCCGCAGGGCGTCGACCCCGCGCTTCACCCCTCCTTCGCCGCCACCCTCCGCCGCTCCTGCCCACCCAACAACACCGCCAGGTCT
GCCGGCTCCTCCCTCGACCCCACCTCCTCCGCCTTCGACAACTTCTACTATCGGATGCTGCTCTCCGGCCGTGGCCTTCTCTCCTCCGACGAGGCGCTGCTCACCCACCCCAAGACGCGC
GCCCAGGTCACGCTCTACGCCGCGTCGCAGCCCGCCTTCTTCCGTGACTTCGTCGACTCCATGCTACGGATGAGCTCCCTCAACAACGTCGCCGGCGAGGTCCGAGCCAACTGCAGGCGC
GTCAACTAG

Retrieve as FASTA