Entry information : EcamPrx133 ( EcC030049.30)
Entry ID 10421
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-03-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EcamPrx133 ( EcC030049.30)
Name (synonym) EcamPrx133 ( EcC030049.30)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx133
start..stop
S start..stop
EglPrx133 673 0 1..327 1..327
EgrPrx133 672 0 1..327 1..327
EguPrx133 667 0 1..327 1..327
RcPrx53 509 0 10..327 2..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..252 252 N° 2 409..597 189 N° 3 700..862 163 N° 4 1327..1706 380
join(1..252,409..597,700..862,1327..1706)


exon

Literature and cross-references EcamPrx133 ( EcC030049.30)
Protein sequence: EcamPrx133 ( EcC030049.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   35655.39 Transmb domain:   %s   i12-34o
PI (pH):   %s   6.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARVKNRAAADVMWVVMLLMQMMGLIRSFNFGIGGVDGLRMDYYFMSCPFAEQIVWNSVTSALQSDPTLAAGLLRMHFHDCFIQGCDGSVLLDSTKDNTAEKDSPANLSLRGYEVIDDAKEQIEEQCPGVVSCADILAMAARDAVFWAGGPRYEIPKGRKDGARSRIEDTINLPSPTFNASELIRMFGQHGFSAQEMVALSGGHTLGVARCSSFKQRLSNSDPTLDSSFAKTLSKTCSAGDNAEQPFDATRNTFDGAYYYGLVNKAGVLTSDQTLFASARTKGIVNGYAMNQAMFFFDFQQAMLKMSLLDVKEGSAGQVRLNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGGTGAAGAATAGAGCTGCGGCGGACGTGATGTGGGTGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCTGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GTATTCCACTCCAACCCTCGAGTTACCGCATGTATGCGTACACACACATAGTTTAACTATACACAAAACGAGCTCATCACGTGGATCCATATATGTAGGCAATGACTT
TCTGTGCTGCTTGTTGAGCCTGAACATGGACTTTATGCGCGTGTACAGGGATGCGATGGGTCGGTGTTGCTGGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACTTA
AGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAGGAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GTA
ATATTTTCAGCCTACATCCGTCATGAGCGCAAGCCTGAGTCACCCCCCTCCTCTCACTCTCCTCTTTCAACTCTCCTGACGTAACCATATGAATTACAGGCGGGAGGTCCAAGATACGAA
ATACCGAAAGGGAGGAAGGACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTCCCGTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGCCAGCACGGCTTCTCCGCC
CAAGAGATGGTCGCTCTGTCCG
GTATTCGATCGCTTCTCTCTTTTTCTCAGCCCGAGTTATCCTATACCTAACATGCATCTATATTCAAGGAATATGTTTACATGGTCTAATGTAACAAG
AAACCTTCACATCAATCCAAATCAATCCTCGCATGCAAAAAGCTATTCAATGAAAACATCACGCACTAAGTCGTAAATCATCTCTCGAGCATCCAATGCTATCTACAGGAGTGACCGACA
CTCTAGAACATAGATGGCATGACCCACAAAGACCAATTAAATGTATTAGTTAAGGGTCGATGAAAGGTACAGACAAGCTAATTTGTCTTGTTTTAGGTCACGCAAATCTTTGATCTAGGA
TCGCCTTCCCTTTACATCAATAATTTATCAAAGGCACTGCTCCCATAAATCATGCAAAAACATGTACAAGCAAATCATGGAGCGGATCGTGTCTTTCGCTAATTTGTAATCAATCGAGTC
CGATAGGTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGACTCCAGCTTCGCCAAGACGCTGTCCAAGACGTGCAGTGCCG
GGGACAACGCAGAGCAGCCGTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGCGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCC
GGACCAAAGGGATTGTGAACGGGTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGACGTCAAGGAAGGCTCCGCCGGCCAGGTCC
GTCTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGGTGAAGAATAGAGCTGCGGCGGACGTGATGTGGGTGGTGATGTTGTTGATGCAGATGATGGGGTTGATCAGGTCGTTCAATTTCGGGATAGGAGGAGTCGACGGGCTGAGA
ATGGACTACTACTTCATGTCCTGCCCCTTCGCCGAGCAGATTGTCTGGAACTCCGTCACCTCCGCCCTCCAGTCCGACCCTACGCTTGCTGCTGGCCTCCTTCGCATGCATTTCCACGAC
TGCTTCATTCAG
GGATGCGATGGGTCGGTGTTGCTGGATTCGACCAAGGACAACACCGCAGAGAAAGACTCGCCCGCGAACTTAAGCTTGAGAGGGTACGAAGTGATCGACGATGCGAAG
GAGCAGATCGAAGAGCAATGCCCGGGCGTCGTCTCCTGCGCCGATATCTTGGCCATGGCCGCCAGAGATGCTGTGTTCTGG
GCGGGAGGTCCAAGATACGAAATACCGAAAGGGAGGAAG
GACGGAGCGAGATCGAGGATAGAGGACACCATCAACCTCCCGTCTCCCACCTTCAACGCCTCCGAACTCATTCGCATGTTCGGCCAGCACGGCTTCTCCGCCCAAGAGATGGTCGCTCTG
TCCG
GTGGACACACGTTGGGAGTGGCAAGGTGCTCGTCGTTCAAGCAAAGGCTGAGCAACTCCGACCCGACCCTCGACTCCAGCTTCGCCAAGACGCTGTCCAAGACGTGCAGTGCCGGG
GACAACGCAGAGCAGCCGTTCGACGCCACGCGGAACACCTTCGACGGCGCCTACTACTACGGCCTCGTCAACAAGGCGGGCGTGCTGACGTCGGACCAGACCCTGTTCGCCAGCGCCCGG
ACCAAAGGGATTGTGAACGGGTACGCCATGAACCAGGCCATGTTCTTCTTCGACTTCCAGCAGGCCATGCTCAAGATGAGCCTGCTCGACGTCAAGGAAGGCTCCGCCGGCCAGGTCCGT
CTCAATTGTCGCAAGATCAACTGA

Retrieve as FASTA