Entry information : EcamPrx97 ( EcC032675.10)
Entry ID 10426
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EcamPrx97 ( EcC032675.10)
Name (synonym) EcamPrx97 ( EcC032675.10)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx97
start..stop
S start..stop
EglPrx97 713 0 1..350 1..350
EgrPrx97 710 0 1..350 1..350
EguPrx97 679 0 1..350 1..350
EcamPrx96 641 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..234 234 N° 2 958..1152 195 N° 3 2491..3111 621  
join(1..234,958..1152,2491..3111)


exon

Literature and cross-references EcamPrx97 ( EcC032675.10)
Protein sequence: EcamPrx97 ( EcC032675.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   38050.11 (35357.7)  
PI (pH):   %s   4.92 (4.77) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRFSSFVLISCLVIASSPVHVSSSAHLVKGLSWSFYEKSCPKVESVIRKHLKKVFEEDIGQAAGLLRVHFHDCFVKGCDGSVLLDGSASEPSEQDAPPNRSLRRTAFKIIDDLSQLVEKKCGQVVSCADIAAIAARDSVFLSGGPEYDVPLGRRDGLTPATxNVVVENIPAPTENASEILSALAKKNFDPTDVVALSGGHTIGLAHCTAFENRLYPTQDPTMEKTFAHDLKGVCPTTNSTNTTVLDIRSPNRFDNKYFVDLVNRQGLFTSDQDLYEDPTTRDIVTSFAEDQELFFEKFVLAMTKMGQLSVLTGTKGEIRANCSVRNSENPDLLKSVVEEDLESYAELK

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Incorrect prediction from kazusa (Extra 5' end has been removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCCGTTTCAGCTCTTTCGTTTTGATTTCTTGTCTCGTGATAGCTTCATCGCCTGTTCATGTCTCGAGCTCTGCTCACTTAGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAA
AGCTGTCCCAAGGTTGAGTCCGTCATCAGGAAACATCTCAAGAAGGTGTTTGAGGAGGACATTGGCCAAGCTGCCGGGCTACTTCGTGTGCACTTCCATGACTGCTTTGTTAAG
GTAGGT
ACCAAGGAGCTCTGTCACAATCTGCATTCACTACACCGGGCAAAGTGATTTGGGATTTACTTGAAAGTTGTATCTTGATTTGCTCGTCACATGTCCTTATATATGGTGGTCAGCTATGTT
AACATGTTTGCACAACCTTTTGGCAAAATCTGTGATCATCATCTTCTTCCCCGGCAAAATAGACGAGAATAAGAAAAGACAAAGTTCTTGTCGAGTTGGTGGCCTAGGTTAGCAGCTGCA
AGAAGTGAACTTCTTTCCTTTTGATATTGCTAATTTTTAGAATGCTGGGTAGATAGTCATACGGGTGCCTAAAGCCATCACGACTTTGTCTTTTAGCATACTAATCTGACTGTCTTACTA
GTAAACACTTGCTGAAGTTTTGGAGGATGCTTTTTGAGCGTTTGACATAGTTGATTCTGATCTTTAGTGCTTTATATGCTAAAGTGAAGAGCATAGAAGTTCATAGAACTCCCATGATCA
GGTTTTAGACAGAACTGCTGTAATAATTCTCGTAAATTGTCTTCATAAGATGATTGTATGAGCAGTCCAGTTAAGCCCGGATTGTGTGTGGTGAGGATTTTTTCGCTTTGAAGGTTAGGA
TGGGTTTAAGTCATCGCAGTTTCTTTTACAATTGAATCTTGATCACTTACATTAAAATAAATGATAAAACATTCTCTGAATTCACGCTTATTTTTTAAGATCTGATGAGTGATGCAGGGA
TGCGATGGTTCGGTGTTGCTGGATGGATCAGCAAGTGAACCAAGTGAGCAAGACGCTCCACCAAACAGGAGCTTGAGACGGACAGCATTCAAGATCATTGATGACCTCAGTCAGCTCGTG
GAGAAGAAATGTGGTCAAGTAGTCTCTTGTGCCGACATCGCTGCCATTGCCGCTCGTGATTCCGTTTTCCTG
GTAAACCCCCTTCAGCCATCATTCCATCATCACTAGAGAGTAACGCAC
CAAAACAGAGTTCTGATTATGATACTCGCCAGATTCTGATTATCATACTATTGGAATTTTGATAGAAGTACAGATTCTTGCCGAACATGCTTATCCATATAAATCATACTAATTTGCAGC
TTTGAATGACGCTTTTGCATTTGGTAATGGGAAGGCAAATATGATCATAAGCTTTCAAAATAGAGCAACAGCAGAATACAGTATTGGTCAGTTAGCTACTTCCTAGATAATTGTAATAGT
TCTTATGTTCAAGTTGATAAATGGATTTCTTTTTAGGGATTAATTGGATTATCGAACTAACCAAACATATAGTAAGTTACACGTTCACACAGAACTTTCACTGATTGGATGTTCCCCCTC
CGTTAAACATTCAACCACTCCCCATTAATCTGCTGTTTTTGGAAATCAAGTTGATGTATAAAATACCCCAAACCTAACAGAATGTGGACCTTCGCAAGATGGTACTGGAACTTTGATCTC
GTCATGTGGCCATGTGACAGACAATAGTTGTTTAACAACTCCTACTCTTGATTAGGTTCAGGCTTGATTATACTCATTAGTTATGATGATAATTATACTTTATCGCTCTCACAATGGTAA
TGTTCGATGATGCTTGGTAAGAGGAATTATAAATCACAAGAAAGTGGACTCGCTGATGTAACCAAGCGTGGTTAAACTATATATGGATTCGTGTAGTTTCCTCCTGTTCGTGTTCTGAAT
GTTTTGTGAGATGTAGCAGATGTCCAGTTAAGTCGGCAGCATTATCTTGGAAACTCAGGACAATTAAACCTGTCATTATGAGCCAAAAAGATCAGTATACAGCAAATTTCAATGGTCAAA
ACTGAGACATCGTCGTTGTTTATATCTGAGTTTTAACGGGTGGTTATCACCATTTTTTTAAGATCCCAACCAGTCGGAGGTTTATTCTGAATTTTGGGATCATGTTTATGGATAATATAC
TGCAACTTGACATGTCTTTGGACTGTTTCAACATGGTCAGGTAAGCATGTGCTTCCAAAGTTCTTGGAAATTGCAGTTGAAACGACAACCTAGGTAGACGATTCTGTTTAATGACAATCT
ACTCCCGACTAGCTTCTAGTTTATGAGAGTTGACTTGCAAATGATCACCTCCACACGAAGAAGACATCAAAGTTCTCCGCTGGCTTCATGTCCTATACATGATCGAAGTTTTCTCGATTA
TGATTACTATTGCCCATCATATCAATGAGCATCAACAGATGTTTTCCAAGTTCTGGATTCTAATTCTGTTATTCTCGTCGTCGTGTGCAGTCAGGCGGACCTGAGTATGATGTGCCGTTG
GGAAGGCGGGATGGACTTACGCCTGCGACTGANAATGTGGTCGTAGAGAATATACCTGCACCAACTGAGAACGCCAGTGAAATTCTCTCCGCCCTAGCCAAGAAAAACTTCGACCCTACC
GACGTAGTGGCCCTCTCTGGAGGCCACACCATTGGGCTTGCGCACTGCACCGCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACCATGGAGAAGACCTTTGCCCATGATCTCAAG
GGCGTGTGCCCCACCACAAACTCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTCGATTTGGTGAACCGCCAAGGCCTGTTCACCTCAGAC
CAAGATCTGTATGAGGATCCCACAACGAGGGACATCGTCACTAGCTTCGCCGAGGACCAGGAATTGTTCTTCGAGAAGTTTGTCCTAGCTATGACGAAGATGGGACAACTCAGTGTGTTG
ACAGGGACGAAAGGAGAAATCCGAGCCAACTGCTCGGTCAGGAATTCTGAGAACCCCGATCTCTTGAAGTCCGTGGTGGAAGAGGACCTGGAGAGCTATGCTGAATTGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCCGTTTCAGCTCTTTCGTTTTGATTTCTTGTCTCGTGATAGCTTCATCGCCTGTTCATGTCTCGAGCTCTGCTCACTTAGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAA
AGCTGTCCCAAGGTTGAGTCCGTCATCAGGAAACATCTCAAGAAGGTGTTTGAGGAGGACATTGGCCAAGCTGCCGGGCTACTTCGTGTGCACTTCCATGACTGCTTTGTTAAG
GGATGC
GATGGTTCGGTGTTGCTGGATGGATCAGCAAGTGAACCAAGTGAGCAAGACGCTCCACCAAACAGGAGCTTGAGACGGACAGCATTCAAGATCATTGATGACCTCAGTCAGCTCGTGGAG
AAGAAATGTGGTCAAGTAGTCTCTTGTGCCGACATCGCTGCCATTGCCGCTCGTGATTCCGTTTTCCTG
TCAGGCGGACCTGAGTATGATGTGCCGTTGGGAAGGCGGGATGGACTTACG
CCTGCGACTGANAATGTGGTCGTAGAGAATATACCTGCACCAACTGAGAACGCCAGTGAAATTCTCTCCGCCCTAGCCAAGAAAAACTTCGACCCTACCGACGTAGTGGCCCTCTCTGGA
GGCCACACCATTGGGCTTGCGCACTGCACCGCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACCATGGAGAAGACCTTTGCCCATGATCTCAAGGGCGTGTGCCCCACCACAAAC
TCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTCGATTTGGTGAACCGCCAAGGCCTGTTCACCTCAGACCAAGATCTGTATGAGGATCCC
ACAACGAGGGACATCGTCACTAGCTTCGCCGAGGACCAGGAATTGTTCTTCGAGAAGTTTGTCCTAGCTATGACGAAGATGGGACAACTCAGTGTGTTGACAGGGACGAAAGGAGAAATC
CGAGCCAACTGCTCGGTCAGGAATTCTGAGAACCCCGATCTCTTGAAGTCCGTGGTGGAAGAGGACCTGGAGAGCTATGCTGAATTGAAA

Retrieve as FASTA