Entry information : EcamPrx96 ( EcC032675.30)
Entry ID 10427
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-11 (Christophe Dunand)
Peroxidase information: EcamPrx96 ( EcC032675.30)
Name (synonym) EcamPrx96 ( EcC032675.30)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx96
start..stop
S start..stop
EglPrx96 718 0 1..350 1..350
EgrPrx96 717 0 1..350 1..350
EcamPrx97 642 0 1..350 1..350
EglPrx97 642 0 1..350 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26512..26745 234 N° 2 27476..27670 195 N° 3 28876..29496 621  
join(26512..26745,27476..27670,28876..29496)


exon

Literature and cross-references EcamPrx96 ( EcC032675.30)
Protein sequence: EcamPrx96 ( EcC032675.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   38130.27 (35355.8)  
PI (pH):   %s   5.42 (5.00) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRFSSFVLISFLVIAASHVHVTSSAHLVKGLSWSFYEKSCPKVESVIRKHLKKVFEEDIGQAAGLLRLHFHDCFVKGCDASVLLDGSASGPSEQDAPPNRSLRPTAFKIINDLRELVDKKCGRVVSCADIAAIAARDSVVLSGGPEYDVPLGRRDGLTFATQNVTLENLPAPTENASAILSALAKKNLDATDVVALSGGHTIGLGHCTSFENRLYPTQDPTMEKTFAHDLKGVCPTTNSTNTTVLDIRSPNRFDNKYFVDLVNRQGLFTSDQDLYEDPATRDIVTSFAEDQELFFEKFVLAMTKMGQFGLLTGTKGEIRANCSVRNSENPDLLKSVVEEDLESYAELK

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCCGTTTCAGCTCTTTCGTTTTGATTTCTTTTCTTGTGATAGCTGCATCACATGTTCATGTTACGAGCTCTGCTCACTTGGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAG
AGCTGTCCCAAGGTGGAGTCCGTCATCAGGAAACATCTCAAGAAGGTGTTCGAGGAGGATATTGGCCAAGCTGCTGGGCTGCTTCGTCTGCACTTCCATGACTGCTTTGTTAAG
GTAGGT
ACACAGCGAGCTCCGCCGCATTCACTCTAACGGGGCAAAGAGATTTGCGATTTTCTTAGAAGTTGTATCTTGATTTGCTCATCACATGTCCTTGTGTAAGATGGTAAAGCGGATCGTTAA
ACGTTCACACACACTTTTTGGCAAGATGTGTGATCATCTTCACCAAAATAGACGAGATTAAGAAGTGAGATGCCAACAAAAAAACGAAAAAATCTTCTCGAGCTGGTGGCTTAGTTTAGC
AGCTGCAAGAAGTGGACTTTAAAAAAAAAAAAGAAATTCATGATGCTGGGTAGATTACCAAGTCATGTGGGTGCCTGAAGCCATCGTCACTTCGTCTTTTAGCATACAAATATTACTGTC
TTATTAGTAAACACTTGTTGAAGTTTTGGAGGATGCTTTTTGAGCGTTTGACATAGTTGGTCCTGATCTTTAGTGCTTTATATGCTAAAATGAAGAACATAGAAGTTCACAGAACTCCCA
TGTTCTGCTGTTATAAAGAGCTGCAGTAATAATTTCTGGTAAATTGTCTTCATAAGATGATTGCACGAGCAGTCTAGTTAAGCCCGGATTGTGTGGGGCGAGGATTTTTTTCACTTTGAA
GGTTAGGATGGGTTTAAGTCATCACGGTTTCTTTTACAATTGAATCTCGATCACTTACATTCAAATAAATGATAAAATATTCTTCAAATTCACGCTTATTTTTGAGTTCTGATGAGTGAT
GCAGGGATGTGATGCTTCGGTGTTGCTGGATGGATCAGCCAGTGGACCAAGTGAGCAGGACGCTCCACCGAACCGGAGCTTGAGACCAACAGCATTCAAGATCATCAATGACCTCCGTGA
GCTCGTGGACAAGAAGTGTGGTCGAGTAGTCTCTTGTGCTGATATCGCGGCCATTGCTGCTCGTGACTCCGTTGTCCTG
GTAAGCCCCCCTTAAGCTATCATTCCATCATCACTAGAGAG
TAACACACCAAAACAGAGTTCTGACTATGATACTTGCCACGTACAAACCATTTAGGCATTCTTGAGCTCATACTATCGAAAATTTGATAGAAATACAGATTCTTGCCGAACATGCTCGTC
CCTGTAAATGGTACTGATTTGCAGTCTGTATGATGCTTTTGCATTTGGTGGTGGGAAGGCAATTATGATCATAAGCTTTCAAAATAGAGCAACAGCAGAAAACAGTATCGGTCAGTTAGC
TAGCTTCCTAGATAATTGTAATAGTTCTTATGTTCAAGTTGATAAATGGATTTCCTTTTGGAGATTAATTGGATTATCAAACTAACCAAACATATNNNNNNNNNNNNNNNNNNNNTGATC
TCGGTCATGTGACCATGCGACAACAAGAGTTGTTTGACCACTCTTGTTTAGGCTCAGGCTTGATTGTACTCATTAGTTATGGTGATAATTATACTTTATTGCTCTCTCAATGGTAATGAT
CGATGATGCTTGGTAAGAGGAATTATAAATCATGAGAAAGTGGACTCGCTGATGTAACCAAGCGTGGTTAAACTATATTTGGATTCTTGTAGTTTCCTCCTGTTCGTGTTCTGAATATCT
TGTGAGATGTAGCAGATGTCCATGTAAGTCGGCAGCATTATCTTGGAAACTCAGGACAATTAACCTGTCATTCTGAGCCAAAAAGTGTAGTATACAGCAAATTTCAATGGTCAAAACTGA
GACATCGTCGTTGTTTATATCTGAGTTTTAACGGGTAGTCATCACCATTTTTTTAAGATCCCAACCAGTCGGAGGTCTATTCTGAATTTCAGGATCATGTTTATGGATAAAATACTGCAA
CTTGACATGTCTTTGGACTCTTTCAACATGGTCGGGTAAGCATGTGGTCACAAAGTTCTTGAAAATTGCAGATGAAATGACAACCTAGGTAGACGATTCTGTTTAATGATAATCTAATCC
CAACTAGCTTCTAGTTTATGAGAGTTGACTTGCAAATGATCACCTCCACACGAAAAGACATCAAAGTTCTCCGTTGGCTTCATGTCCTATACATCATCGAAGTTTTCTCGATTATGATTA
CTTTTGCCCATCATATCAATGAGCGTCAACAGATGTTTTCCGAGTTCTGGATTCTAATTCTGTTATTCTCGTCGTCATGTGCAGTCAGGCGGACCTGAGTACGATGTGCCGTTGGGAAGG
CGGGATGGACTCACGTTTGCGACTCAAAATGTGACCTTAGAGAATTTACCTGCACCAACTGAGAACGCCAGTGCAATTCTCTCCGCCCTAGCCAAGAAAAACTTAGACGCTACCGACGTA
GTGGCCCTCTCTGGAGGCCACACCATCGGGCTTGGGCACTGCACCTCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACGATGGAGAAGACCTTTGCCCATGATCTCAAGGGCGTG
TGCCCCACCACAAACTCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTTGATTTGGTGAACCGCCAAGGCCTGTTCACCTCAGACCAAGAT
CTGTATGAGGATCCTGCAACGAGGGACATTGTCACTAGCTTTGCCGAGGACCAGGAATTGTTCTTTGAGAAGTTTGTCCTAGCCATGACGAAGATGGGGCAATTCGGCTTGTTGACGGGG
ACGAAAGGAGAAATCCGAGCCAACTGCTCAGTCAGGAATTCCGAGAACCCCGATCTCTTGAAGTCCGTGGTGGAAGAGGACCTGGAGAGCTATGCTGAATTGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCCGTTTCAGCTCTTTCGTTTTGATTTCTTTTCTTGTGATAGCTGCATCACATGTTCATGTTACGAGCTCTGCTCACTTGGTGAAGGGGCTCTCGTGGTCCTTCTACGAGAAG
AGCTGTCCCAAGGTGGAGTCCGTCATCAGGAAACATCTCAAGAAGGTGTTCGAGGAGGATATTGGCCAAGCTGCTGGGCTGCTTCGTCTGCACTTCCATGACTGCTTTGTTAAG
GGATGT
GATGCTTCGGTGTTGCTGGATGGATCAGCCAGTGGACCAAGTGAGCAGGACGCTCCACCGAACCGGAGCTTGAGACCAACAGCATTCAAGATCATCAATGACCTCCGTGAGCTCGTGGAC
AAGAAGTGTGGTCGAGTAGTCTCTTGTGCTGATATCGCGGCCATTGCTGCTCGTGACTCCGTTGTCCTG
TCAGGCGGACCTGAGTACGATGTGCCGTTGGGAAGGCGGGATGGACTCACG
TTTGCGACTCAAAATGTGACCTTAGAGAATTTACCTGCACCAACTGAGAACGCCAGTGCAATTCTCTCCGCCCTAGCCAAGAAAAACTTAGACGCTACCGACGTAGTGGCCCTCTCTGGA
GGCCACACCATCGGGCTTGGGCACTGCACCTCCTTTGAGAATCGGCTCTACCCGACCCAAGACCCCACGATGGAGAAGACCTTTGCCCATGATCTCAAGGGCGTGTGCCCCACCACAAAC
TCCACCAACACTACGGTCTTGGACATCCGATCACCCAACCGATTCGACAACAAGTACTTTGTTGATTTGGTGAACCGCCAAGGCCTGTTCACCTCAGACCAAGATCTGTATGAGGATCCT
GCAACGAGGGACATTGTCACTAGCTTTGCCGAGGACCAGGAATTGTTCTTTGAGAAGTTTGTCCTAGCCATGACGAAGATGGGGCAATTCGGCTTGTTGACGGGGACGAAAGGAGAAATC
CGAGCCAACTGCTCAGTCAGGAATTCCGAGAACCCCGATCTCTTGAAGTCCGTGGTGGAAGAGGACCTGGAGAGCTATGCTGAATTGAAA

Retrieve as FASTA