Entry information : EcamPrx[P]183 (EcC002679.10)
Entry ID 10428
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-03-15 (Qiang Li)
Peroxidase information: EcamPrx[P]183 (EcC002679.10)
Name (synonym) EcamPrx[P]183 (EcC002679.10)
Class Class III peroxidase     [Orthogroup: Prx031]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]183
start..stop
S start..stop
EgrPrx94 306 8e-106 1..196 1..193
EglPrx94 304 4e-105 1..196 1..193
EcamPrx94 303 1e-104 1..196 1..197
EguPrx94 290 1e-99 1..196 1..193
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..243 243 N° 2 351..734 384  
join(1..243,351..734)


exon

Literature and cross-references EcamPrx[P]183 (EcC002679.10)
Protein sequence: EcamPrx[P]183 (EcC002679.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   208 (189)
PWM (Da):   %s   22621.78 (20641.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.29 (5.28) Peptide Signal:   %s   cut: 20 range:20-208
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEVLASSVLFLVALHLVSAAVQAGGLLGTVPIEEYGLSFQ*YQQSCPQFEAFVGRKVKEWIKDYTLAPALMRLHFLDCVVRGCNTSILLNHEGSERSAEVSKTLRGFEIIDDIKTELEKSCLRTASCVDSLATAVRDATVSAGGPYWMVPYGCKDGRVSVAREADKVPMGHENITSLLQLFQSQGLNVLDLVVLSGELLLLLLFSKIKE

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGTTCTCGCATCATCAGTGCTGTTTCTGGTCGCTCTTCACTTGGTTTCAGCCGCGGTCCAAGCTGGAGGGCTGCTCGGGACGGTGCCGATAGAAGAGTACGGGCTGTCGTTCCAG
TAATACCAGCAGAGTTGCCCCCAATTCGAGGCCTTCGTGGGCAGGAAGGTGAAGGAATGGATCAAGGACTATACATTAGCGCCTGCCCTAATGAGGTTGCATTTCCTTGACTGCGTCGTT
AGG
GTACATAGTTTGTCCAGCTGCTATTTATTTTGATTGCTATCAAGAAAGTGAATGATTGAATTTTTCCAGACTTCATTTAACTTGGTTATTATGATTAATTTGTATAGGGATGTAACA
CGTCGATATTGTTGAACCATGAGGGAAGCGAGAGAAGCGCTGAAGTGAGCAAGACCCTTAGGGGGTTCGAAATAATCGACGACATAAAGACGGAGCTCGAGAAGAGCTGCCTGAGGACAG
CATCGTGCGTCGACAGTCTGGCTACAGCCGTGAGGGACGCCACCGTGTCAGCCGGCGGGCCATACTGGATGGTGCCGTATGGATGCAAGGACGGGAGAGTCTCCGTCGCCAGGGAGGCCG
ACAAGGTGCCGATGGGCCACGAGAACATCACGTCGCTCCTCCAGCTCTTCCAATCCCAAGGATTAAATGTCCTTGACTTGGTTGTTCTCTCAGGTGAACTTCTTTTATTGCTTCTATTTT
CAAAAATCAAAGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGTTCTCGCATCATCAGTGCTGTTTCTGGTCGCTCTTCACTTGGTTTCAGCCGCGGTCCAAGCTGGAGGGCTGCTCGGGACGGTGCCGATAGAAGAGTACGGGCTGTCGTTCCAG
TAATACCAGCAGAGTTGCCCCCAATTCGAGGCCTTCGTGGGCAGGAAGGTGAAGGAATGGATCAAGGACTATACATTAGCGCCTGCCCTAATGAGGTTGCATTTCCTTGACTGCGTCGTT
AGG
GGATGTAACACGTCGATATTGTTGAACCATGAGGGAAGCGAGAGAAGCGCTGAAGTGAGCAAGACCCTTAGGGGGTTCGAAATAATCGACGACATAAAGACGGAGCTCGAGAAGAGC
TGCCTGAGGACAGCATCGTGCGTCGACAGTCTGGCTACAGCCGTGAGGGACGCCACCGTGTCAGCCGGCGGGCCATACTGGATGGTGCCGTATGGATGCAAGGACGGGAGAGTCTCCGTC
GCCAGGGAGGCCGACAAGGTGCCGATGGGCCACGAGAACATCACGTCGCTCCTCCAGCTCTTCCAATCCCAAGGATTAAATGTCCTTGACTTGGTTGTTCTCTCAGGTGAACTTCTTTTA
TTGCTTCTATTTTCAAAAATCAAAGAA

Retrieve as FASTA