Entry information : EcamPrx[P]99 ( EcC032928.10)
Entry ID 10429
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EcamPrx[P]99 ( EcC032928.10)
Name (synonym) EcamPrx[P]99 ( EcC032928.10)
Class Class III peroxidase     [Orthogroup: Prx031]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]99
start..stop
S start..stop
EglPrx94 263 1e-89 1..156 66..221
EgrPrx94 263 1e-89 1..156 66..221
EcamPrx94 257 3e-87 1..156 66..225
EguPrx94 251 4e-85 1..156 66..221
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..39 39 N° 2 147..489 343 N° 3 772..857 86  
join(1..39,147..489,772..857)


exon

Literature and cross-references EcamPrx[P]99 ( EcC032928.10)
Protein sequence: EcamPrx[P]99 ( EcC032928.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   154
PWM (Da):   %s   16634.39  
PI (pH):   %s   7.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ALMRLHFHDCVVRGCDASILLNHEESERSAEASKTLRGFEIINDINTELEKSCPRTALCADILTAATKDATVSAGGLY*MMPYGRKDGRVSVAGEADKVPMGHENITSLLQLFQSQGLNVLDLVVLSGAHTIGRRACRPVQSRLYNY*STGKPDP

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (3' end is missing due to NNNNNN in DNA, short 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCCTAATGAGGTTGCATTTCCATGACTGCGTCGTTAGGGTAGGTAGTTTGTCCAACTGCTATTCATTATGATCGCTATCAACAAAGTGAATGATTGAATTTGTCTAGGCTCCATTTAAC
TTGGTTATTATGATTGATTTGTATAGGGATGTGACGCGTCGATATTGTTGAACCATGAGGAGAGCGAGAGGAGCGCTGAAGCGAGCAAGACCCTTAGGGGGTTTGAGATAATCAATGACA
TAAATACGGAGCTCGAGAAGAGCTGCCCGAGGACAGCATTATGCGCCGACATCCTGACTGCAGCCACGAAGGACGCCACCGTTTCAGCTGGCGGGCTATACTAGATGATGCCGTACGGAC
GCAAGGACGGGAGAGTCTCCGTCGCCGGGGAGGCCGACAAGGTGCCGATGGGCCACGAGAACATCACGTCGCTCCTCCAGCTCTTCCAATCCCAAGGATTAAATGTCCTTGACTTGGTTG
TTCTCTCAG
GTGAACTTCTTGTATTGCTTCTATTTTCAAAAATCAAAGAATAAATAAAAAAATATATAATAAAATCTAAAACACTATGTTCCATTTACTCACAGATGAAAGTGAGATGAA
ATTTGATTATTTATCATTTATATTGCAACGTTAGTCTCAAGGGTGATTTTCGAATGGATGTAAGGAATAATTTATGAAATTTTGCGGTACATTTTTATCATTATTTTTTCTTTCTTCTTG
ATTTTTGCATTTCACAATAAAGTCGTAAAAACTGTTACAAATTCGGTGTAGGCGCGCACACGATAGGGCGAAGAGCCTGCAGGCCCGTCCAATCACGGCTCTACAACTACTAGTCCACCG
GAAAGCCCGACCCGACC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCCTAATGAGGTTGCATTTCCATGACTGCGTCGTTAGGGGATGTGACGCGTCGATATTGTTGAACCATGAGGAGAGCGAGAGGAGCGCTGAAGCGAGCAAGACCCTTAGGGGGTTTGAG
ATAATCAATGACATAAATACGGAGCTCGAGAAGAGCTGCCCGAGGACAGCATTATGCGCCGACATCCTGACTGCAGCCACGAAGGACGCCACCGTTTCAGCTGGCGGGCTATACTAGATG
ATGCCGTACGGACGCAAGGACGGGAGAGTCTCCGTCGCCGGGGAGGCCGACAAGGTGCCGATGGGCCACGAGAACATCACGTCGCTCCTCCAGCTCTTCCAATCCCAAGGATTAAATGTC
CTTGACTTGGTTGTTCTCTCAG
GCGCGCACACGATAGGGCGAAGAGCCTGCAGGCCCGTCCAATCACGGCTCTACAACTACTAGTCCACCGGAAAGCCCGACCCGACC

Retrieve as FASTA