Entry information : OsPrx33
Entry ID 1043
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx33
Name OsPrx33
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Leaves
Pannicles
Roots
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx33
start..stop
S start..stop
SiPrx154 527 0 1..311 21..331
PedPrx04 515 0 1..311 13..326
SbPrx23_BTx623 503 0 7..311 30..333
SofPrx03 500 0 4..311 24..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1155473..1155640 168 N° 2 1154684..1154872 189 N° 3 1152280..1152858 579  
complement(join(1152280..1152858,1154684..1154872,1155473..1155640))


exon

Literature and cross-references OsPrx33
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8LMR7
DNA ref. GenBank:   NC_008396.1 (1155640..1152283)
Protein sequence: OsPrx33
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311
PWM (Da):   %s   32127.56  
PI (pH):   %s   4.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMATRSQAQLQVGYYDTLCPAAEIIVQEEVSKAVSGNPGMAAGLVRLHFHDCFVRGCDASVLLDSTQGNRAEKDAPPNTSLRGFEVIDSAKSRLETACFGVVSCADVLAFAARDALALVGGNAYQVPGGRRDGNVSVAQETNGNLPPPSANVAQLNQMFGAKGLTQAEMVALSGAHTIGVSHCSSFSNRLYSSGPNAGQDPSMDPSYVAALTTQCPQQQGQPAAGMVPMDAVTPNAFDTNYYAAIVANRGLLSSDQALLADQTTAAQVVGYTNNPDSFQTDFAAAMVKMGSIGVLTGNAGTIRTNCRVAS*

Retrieve as FASTA  
Remarks chromosome 3. 12 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGGCGACGAGGTCGCAGGCGCAGCTGCAGGTCGGGTACTACGACACGCTGTGCCCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGCGGTGTCCGGGAACCCCGGC
ATGGCCGCCGGCCTCGTCCGTCTCCACTTCCACGACTGCTTCGTCAGG
GTCAGTACAGTAACTAATAGTAACTTATTACACCACCAAATTCGGTTCCTCCATTAATGAGACCACGTATAC
TAGCTTGTTGGGGATGTGAAGCTAATTAAGCTAGAGATAGATGCCTTTGCAAAGTTGCAACTGCATATATGCGGCGGCTGCACATACAAGTGTTTTTTTGAGTGATCCAATGGTTGCAAC
GTGATGTCACTGTGGGGATGTGCTTCGCTTGCATATGGAGCCTCTGCATCTCTTTTGCCGCGCACCCTGCTCTGCTTCGTCCGTTTCTCGCGTATGTAGTACTGTACTTAATTTTACTGC
GAGGATGATAAGCCGATCGAGGTAGGGGAATAATGCACGCACGGTAGATTGCTGCACCGTGTCTGCACCTGCACGGAACGATGGGATACTCTGGAACCATGACAGCTAGAAATCGCTCGT
TCATGTTTGCCATCTGGCATCCCCTGTTTTATCCTAGCATCCAAAACATTAGTACAGTGCTACAGTCAATCAATCAAGCACGTAGTACCTGTGTTACCTAATTTACTGCATTCGTTTTGA
CATGTGGTGCACGTAATAGCGAGACACCTGAATTCCTTGTGGATGCAGGGGTGCGACGCGTCGGTGCTGCTGGACTCGACGCAGGGGAACAGGGCGGAGAAGGACGCGCCCCCGAACACG
AGCCTCCGCGGCTTCGAGGTCATCGACAGCGCCAAGTCCCGCCTCGAGACGGCCTGCTTCGGCGTCGTCTCCTGCGCCGACGTCCTCGCCTTCGCCGCCCGGGACGCCCTCGCGCTG
GTA
CGTACGTTTTCTTCTGCTCCATTGAATTACCAGCTGCTTCCTCCGGCGCATCACTGCTAGTGCTTGCTACTTGCCCGTGCGGGTACAAGTCGGGGGGGATCACAACGCGCACGGCGCACG
GTTGATTCGTCGGTGGATTGGGTGATTTGCGAGTGATAGATAGATAGATCGAGCCTGGAATATAAAACCGGTCGGGCCCTACACGGATTGCCCCAACTTTCGTTCTATCTTTCTCCAAAA
GCTGACGCTGAAAGTAGTTGTACTCCGACTGGCAGTAGGAACTTACTCTGTTCTTCTCCTTTCCGATCGATGCTGCCGGCCCGACCCGGCGTAGAATGGGAGGTGATTCATTGCCGATGC
TTTTCTGGAAGCAACGCACCACGGCGGCATCACGCACGATATGTGCCGATGCCGCGATGCGACTGCAGGAGAAGCAGAGGCCGCTCTTTTTCTTTTGTTTTGGTTGGTTCACGTATAATG
AGCCCGTTGTCTGCACGGACCCACCGGTCGGTGTCCGTATCAGCGTCACATGGCCGTGTCGCCCTCACACAGGTTAAGGAAAAGAGAGCCTTTGCTTTCCAAAATCGATCATCTTTTGGG
GATGCGCCAAAAGAATGGAGATTAAGTAATCCAATCTGATCGTGGGATCATGGCACTTGGCACACTAATAAAGTTCACTTTAACCCTCTGGGGGTGATGAACAGTTATTTTAGGAGGCTG
GTGTGATGGGCCAACTCCAATCATTCCTAATCTAGCTTTGCTCCGATCTCCATGCAAACAAATCGTAAACTGTATCGCCATGCAATTCAGTGTAGAAGGAAGTTGAGACATCGATCGGAG
CAAAATTATGGAGTACTAGTACTAGTACGTTCGTATGATTATATTGATTCAGTTGGACTAAATTTGATTATTACTGACGCCACAACGGTAAAGTAGGAGCATTACGACATGATATATACG
GTCAGCAGGTTTAGAACCATTTTTTGTGTTACATGTGTTTTTTAAATGAACATTACTGATCATACGACCGTTGCAGTTTCATATTGTTCAAGTTGACATATTCTGAACAAGTAGTCAAAG
ATTCCTCACTAGTGGTAAGTCAATGGAGTATACAGTATATACCACCACGTCAATAATTCACAACCGACCAAATGCATGTATTTTCCAAATAGACACTAGCATATTTATCAATTTATGAAC
TCCAAATGGTGCTCTGTTAAGACCGTTATACTGAAACTTCAGCTGGAGCTGGAAACAACACATAGATGATGCGTATGCGTGTGCATAACCTTTCACATCATCACATGATGAAAAAGACAT
ATACCTGCAAAAAGCAACGCTAGTGAGTAGTGACGACTCCAGCCCTCTCCGGTATCAATCAGGATTACATTAGGGGATAACCAAAGAGGAAATTAAATACCGAAAGCTACGAGGAGGGGT
TTAATTCTGGGGGCAGGATGAGCAAGTGGGACGGATAGTTTACGTGGATTCGTCTCACGCCCATGTGGCCGGCACGCCCATCGGTCCACAACACCACATGCCATGGATCGATCGGTTTAG
TTTGTCCCCATTCCCTCCCGTTGTGCGGCCCATGCGTCCCCCCGCCGCTTCACCACCAACCCAATCAACCATGTGCCGCGTCTAACTAACTCGAGAACACAAACCACTGTACGGTTTCCA
TCCCTAATCTACATGTTTCCGTGTATCACATGGATATAGGTACACCGCTGATGCACGAGCCAAGATGACAGCAGCTAAAATTATACTTTTAGTACAGTTTTTGAGAAACAGAGTAACAAT
TGGCGTGCGTGTGTACGTGCAGGTGGGAGGGAACGCGTACCAGGTGCCGGGGGGGAGGAGAGACGGCAACGTGTCGGTGGCGCAGGAGACGAACGGGAACCTGCCGCCGCCGTCGGCGAA
CGTGGCGCAGCTGAACCAGATGTTCGGCGCCAAGGGGCTCACCCAGGCGGAAATGGTGGCACTGTCGGGCGCGCACACCATCGGCGTGTCGCACTGCAGCTCCTTCAGCAACCGCCTCTA
CTCGTCGGGCCCCAACGCCGGGCAGGACCCCAGCATGGACCCCAGCTACGTCGCCGCGCTGACGACGCAGTGCCCGCAGCAGCAGGGGCAGCCCGCGGCGGGGATGGTGCCCATGGACGC
CGTCACGCCCAACGCCTTTGACACCAACTACTACGCCGCCATTGTCGCTAACCGGGGATTGCTCAGCTCCGACCAGGCGCTCCTCGCCGACCAGACCACCGCCGCGCAGGTCGTCGGCTA
CACCAACAACCCGGACTCGTTCCAGACCGACTTCGCCGCCGCCATGGTCAAGATGGGCTCCATCGGCGTGCTCACCGGCAACGCCGGCACCATCAGGACAAACTGCAGGGTGGCCAGCTG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATGGCGACGAGGTCGCAGGCGCAGCTGCAGGTCGGGTACTACGACACGCTGTGCCCGGCGGCGGAGATCATCGTGCAGGAGGAGGTCAGCAAGGCGGTGTCCGGGAACCCCGGC
ATGGCCGCCGGCCTCGTCCGTCTCCACTTCCACGACTGCTTCGTCAGG
GGGTGCGACGCGTCGGTGCTGCTGGACTCGACGCAGGGGAACAGGGCGGAGAAGGACGCGCCCCCGAACACG
AGCCTCCGCGGCTTCGAGGTCATCGACAGCGCCAAGTCCCGCCTCGAGACGGCCTGCTTCGGCGTCGTCTCCTGCGCCGACGTCCTCGCCTTCGCCGCCCGGGACGCCCTCGCGCTG
GTG
GGAGGGAACGCGTACCAGGTGCCGGGGGGGAGGAGAGACGGCAACGTGTCGGTGGCGCAGGAGACGAACGGGAACCTGCCGCCGCCGTCGGCGAACGTGGCGCAGCTGAACCAGATGTTC
GGCGCCAAGGGGCTCACCCAGGCGGAAATGGTGGCACTGTCGGGCGCGCACACCATCGGCGTGTCGCACTGCAGCTCCTTCAGCAACCGCCTCTACTCGTCGGGCCCCAACGCCGGGCAG
GACCCCAGCATGGACCCCAGCTACGTCGCCGCGCTGACGACGCAGTGCCCGCAGCAGCAGGGGCAGCCCGCGGCGGGGATGGTGCCCATGGACGCCGTCACGCCCAACGCCTTTGACACC
AACTACTACGCCGCCATTGTCGCTAACCGGGGATTGCTCAGCTCCGACCAGGCGCTCCTCGCCGACCAGACCACCGCCGCGCAGGTCGTCGGCTACACCAACAACCCGGACTCGTTCCAG
ACCGACTTCGCCGCCGCCATGGTCAAGATGGGCTCCATCGGCGTGCTCACCGGCAACGCCGGCACCATCAGGACAAACTGCAGGGTGGCCAGCTGA

Retrieve as FASTA