Entry information : EcamPrx[P]89 ( EcC039502.20)
Entry ID 10431
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EcamPrx[P]89 ( EcC039502.20)
Name (synonym) EcamPrx[P]89 ( EcC039502.20)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]89
start..stop
S start..stop
EgrPrx[P]89 531 0 1..283 10..291
VvPrx35 404 4e-143 1..283 44..326
BvPrx02 402 5e-142 1..283 83..365
VvPrx34 400 1e-141 1..283 43..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..108 108 N° 2 623..814 192 N° 3 1184..1349 166 N° 4 1510..1892 383
join(1..108,623..814,1184..1349,1510..1892)


exon

Literature and cross-references EcamPrx[P]89 ( EcC039502.20)
Protein sequence: EcamPrx[P]89 ( EcC039502.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   29892.54  
PI (pH):   %s   4.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PLALSIIQDAANTVASSEPRMGSSLLRLHFHDCFVNGCDGSVLLDDMDGFTGEKTAGGNVNSIRGLDVVDYIKTRLEEQCPGSISCADILAAAACDSVVALGGTTWTVQLGRRDSTTASLSAANSDIPSPLSDLSGLISEFAKKGFSAKEMVALSGTHTIGRARCFLFRARIYNEENIDPAFTMS*RQNCPGAGGDDNLVPLETGDGDMFDNNYFKDLVSMKGLLHLDQQLFNNGSADRQVKAYSLDSASFFADLADAMVKMGNLSPLTGTDGEVRTNCRKV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing which can not been found; stop in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTTTGGCTCTGTCCATTATCCAGGACGCCGCGAACACGGTGGCGTCCTCAGAGCCCCGAATGGGATCCTCGCTTCTGCGTCTTCACTTCCACGACTGCTTTGTCAATGCAAGTTCTATT
TTTACTCTTCATGTGTCGTCTTCATCATCAAAGTTCCACCGAAGACATCACTTTGCCATGGCAGATCCAGAACTTAGTATTCAATCCGTGGGTTAAATAGTAGATCGAACACTTGTGTTA
CAGTTTGAGCCCAGACAAGTTTTCACTCAACTTTGTATGCTTCCGAGAACCTTTCATGAGGAGCACAGTAAGACGAACCTAGCATTATACAATTCCCTGCGCGGAAAAAAAAAAACACAT
GACTAGGTTCACACTGCCACTTCATACAAACGAAAGACGAAAAATGAGGCGAGTCTTCAGTAAATGTCACGACCCAATTTCGTATCGCATTGTTTTTCCTAGATTATAAATGTCATATTC
AGTCCTAGTCGATTCTTCTGCTTCCGTCCAAGCTGCTTTATCCGTCGAACTTTGTTCAAGCATAGAGGGAGCAAACGAGGTTGAAGCAAAAGCTTAATGGCTTGTCGACAAAAAAAATCT
AATGATATCGAGGTTTGAACAGGGTTGCGACGGGTCTGTGTTGTTGGACGACATGGATGGATTCACCGGCGAGAAGACGGCCGGCGGCAATGTAAATTCAATCAGGGGTTTGGACGTGGT
CGACTACATTAAGACTCGGCTTGAAGAACAATGCCCCGGGAGCATATCGTGTGCCGACATCCTAGCCGCCGCAGCCTGCGATTCTGTCGTTGCC
GTAAGATGCCTTTTCTACTTGTAGAG
AAACACGAGATACCCTTTTGATCATCTCTCGAAAGAGAAGGGAGACCGAAAATCTCAATAAGCTCGCATTTCTTCTTAACACGGCATGACAAACCAATTGATATTCTCATAAAATATAGT
GGTTATGTGCTACAACCGTTATAGAATCTCCATATTGATGGGTCAGACATGGCAGTATTGGCAAAGAATATTACTTTCCATGCCCATGGCGATGCATTAATCGATGATTTCGGATAATAT
GTTACTCCAAGTATAGTCTTATATCCCTTTTTTAATCAACAAGACAGAATGTGATTATGATCAGATCGATTATACTAATTGGGGATCATGCAATAATTTTCAGTTGGGTGGAACTACGTG
GACCGTTCAACTAGGTAGGAGAGATTCAACCACCGCAAGTTTGAGCGCTGCAAACAGCGATATTCCTTCGCCACTCTCGGACCTTAGCGGTCTCATATCTGAGTTCGCTAAGAAGGGATT
CTCTGCCAAAGAAATGGTCGCCCTCTCAG
GTGTTTCATCTAATTTACTTGGCCTTGACAAAAAATGTCATTAATCTAAGAGAGAAGTATCATTCTTTTGGTCTTCGCATTCTGGAAAGGC
TTTTGATTGTCGCTGAAAGAAAATCGCCCGACCATGATCCACCGTCTTACATGCGCTTTTGTGTCGTAGGAACTCACACGATAGGCCGAGCAAGGTGCTTCCTGTTCCGTGCTCGCATCT
ACAACGAGGAGAACATCGACCCCGCATTCACCATGTCGTAGAGGCAGAACTGTCCCGGTGCAGGCGGGGATGATAATCTCGTGCCGCTTGAGACCGGCGACGGCGACATGTTCGACAATA
ACTACTTCAAGGACCTAGTGAGCATGAAGGGCCTCCTGCACTTGGACCAGCAGCTGTTCAACAACGGATCCGCCGACAGGCAGGTGAAGGCCTACAGCCTCGACTCGGCCTCCTTCTTCG
CCGATCTGGCCGATGCCATGGTGAAGATGGGGAACCTCAGCCCCCTCACAGGAACGGATGGGGAAGTCAGGACCAACTGCAGGAAAGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCTTTGGCTCTGTCCATTATCCAGGACGCCGCGAACACGGTGGCGTCCTCAGAGCCCCGAATGGGATCCTCGCTTCTGCGTCTTCACTTCCACGACTGCTTTGTCAATGGTTGCGACGGG
TCTGTGTTGTTGGACGACATGGATGGATTCACCGGCGAGAAGACGGCCGGCGGCAATGTAAATTCAATCAGGGGTTTGGACGTGGTCGACTACATTAAGACTCGGCTTGAAGAACAATGC
CCCGGGAGCATATCGTGTGCCGACATCCTAGCCGCCGCAGCCTGCGATTCTGTCGTTGCC
TTGGGTGGAACTACGTGGACCGTTCAACTAGGTAGGAGAGATTCAACCACCGCAAGTTTG
AGCGCTGCAAACAGCGATATTCCTTCGCCACTCTCGGACCTTAGCGGTCTCATATCTGAGTTCGCTAAGAAGGGATTCTCTGCCAAAGAAATGGTCGCCCTCTCAG
GAACTCACACGATA
GGCCGAGCAAGGTGCTTCCTGTTCCGTGCTCGCATCTACAACGAGGAGAACATCGACCCCGCATTCACCATGTCGTAGAGGCAGAACTGTCCCGGTGCAGGCGGGGATGATAATCTCGTG
CCGCTTGAGACCGGCGACGGCGACATGTTCGACAATAACTACTTCAAGGACCTAGTGAGCATGAAGGGCCTCCTGCACTTGGACCAGCAGCTGTTCAACAACGGATCCGCCGACAGGCAG
GTGAAGGCCTACAGCCTCGACTCGGCCTCCTTCTTCGCCGATCTGGCCGATGCCATGGTGAAGATGGGGAACCTCAGCCCCCTCACAGGAACGGATGGGGAAGTCAGGACCAACTGCAGG
AAAGTTAAT

Retrieve as FASTA