Entry information : EcamPrx[P]160 ( EcC049690.10)
Entry ID 10433
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EcamPrx[P]160 ( EcC049690.10)
Name (synonym) EcamPrx[P]160 ( EcC049690.10)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]160
start..stop
S start..stop
EglPrx[P]160 405 1e-145 5..249 2..226
EgrPrx[P]160 392 3e-140 5..249 2..250
EguPrx[P]160 389 3e-139 5..249 2..250
EcamPrx[P]159 384 4e-137 5..239 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..203 203 N° 2 316..859 544  
join(1..203,316..859)


exon

Literature and cross-references EcamPrx[P]160 ( EcC049690.10)
Protein sequence: EcamPrx[P]160 ( EcC049690.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   248
PWM (Da):   %s   26525.95  
PI (pH):   %s   4.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTDAGCNASVLLDGSASEPSEQDTPPNRNLRCTVLQIxDLCDLVEKKCGRVVSCADITTIAAHDSIFLSGRPEYDVPLGRRDGLAFASVNETTENLPSPTQSASQILAALAKKSFDATDVVTLSGAHTIGLGHCGTFTDRLYPTSDPTMEKSFAHACAPLQTPRTPQSWTSNHPTDSTTGTLSIW*TGLFTSDQDQYEDPTTRDIVTSFTKDLELFFERFVLAMTKMGQLGLLTGTKGEIQARCSARNS

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stop in frame; 3' end is missing). Incorrect prediction from kazusa .
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGATGCAGGATGCAATGCTTCGGTGTTGCTGGATGGATCAGCGAGTGAACCGAGCGAGCAGGACACCCCACCGAATCGAAACTTGAGATGCACAGTGCTCCAAATCATNGACCTC
TGCGACCTCGTGGAGAAGAAATGTGGTCGGGTAGTCTCTTGTGCTGACATCACCACCATCGCCGCTCACGATTCCATTTTCTT
GGTAAACCCCCTTCAACCTGTTTTGATTATAAGCTTT
ATGTTCTTGCAAGTTGGATTTCTTTATCGGGGATTAATTGTAAATAATGTGACCATGCATAATATAACGTGTGCAGTCGGGCAGACCTGAGTATGACGTGCCATTGGGAAGGCGGGACGG
ACTCGCTTTTGCGTCTGTAAACGAGACCACAGAAAATTTACCTTCACCAACTCAGAGCGCCAGCCAAATTCTCGCTGCCCTAGCCAAGAAAAGCTTCGACGCCACCGATGTAGTGACACT
CTCTGGAGCCCACACCATCGGACTTGGGCACTGTGGCACCTTCACCGATCGGCTCTACCCGACCTCAGACCCCACCATGGAGAAAAGCTTCGCCCATGCATGTGCCCCACTACAAACTCC
ACGAACACCACAGTCCTGGACATCCAATCACCCAACCGATTCGACAACAGGTACTTTGTCAATTTGGTGAACCGGCCTGTTCACGTCGGACCAAGATCAATATGAGGACCCCACAACGAG
GGACATCGTTACTAGCTTTACCAAGGACCTGGAATTGTTCTTCGAGAGGTTTGTTCTCGCTATGACCAAGATGGGGCAGCTTGGCCTGTTGACTGGGACGAAAGGAGAAATCCAAGCCCG
CTGCTCGGCCAGGAATTCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTGATGCAGGATGCAATGCTTCGGTGTTGCTGGATGGATCAGCGAGTGAACCGAGCGAGCAGGACACCCCACCGAATCGAAACTTGAGATGCACAGTGCTCCAAATCATNGACCTC
TGCGACCTCGTGGAGAAGAAATGTGGTCGGGTAGTCTCTTGTGCTGACATCACCACCATCGCCGCTCACGATTCCATTTTCTT
GTCGGGCAGACCTGAGTATGACGTGCCATTGGGAAGG
CGGGACGGACTCGCTTTTGCGTCTGTAAACGAGACCACAGAAAATTTACCTTCACCAACTCAGAGCGCCAGCCAAATTCTCGCTGCCCTAGCCAAGAAAAGCTTCGACGCCACCGATGTA
GTGACACTCTCTGGAGCCCACACCATCGGACTTGGGCACTGTGGCACCTTCACCGATCGGCTCTACCCGACCTCAGACCCCACCATGGAGAAAAGCTTCGCCCATGCATGTGCCCCACTA
CAAACTCCACGAACACCACAGTCCTGGACATCCAATCACCCAACCGATTCGACAACAGGTACTTTGTCAATTTGGTGAACCGGCCTGTTCACGTCGGACCAAGATCAATATGAGGACCCC
ACAACGAGGGACATCGTTACTAGCTTTACCAAGGACCTGGAATTGTTCTTCGAGAGGTTTGTTCTCGCTATGACCAAGATGGGGCAGCTTGGCCTGTTGACTGGGACGAAAGGAGAAATC
CAAGCCCGCTGCTCGGCCAGGAATTCC

Retrieve as FASTA