Entry information : EcamPrx[P]188 (EcC052562.20)
Entry ID 10435
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-05-19 (Christophe Dunand)
Peroxidase information: EcamPrx[P]188 (EcC052562.20)
Name (synonym) EcamPrx[P]188 (EcC052562.20)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]188
start..stop
S start..stop
EgrPrx[P]188 253 4e-87 1..204 8..184
EguPrx[P]188 249 2e-85 1..204 8..186
EglPrx167 204 2e-67 52..204 69..222
EgrPrx167 203 2e-65 52..204 167..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3..78 76 N° 2 994..1333 340 N° 3 2357..2552 196  
join(3..78,994..1333,2357..2552)


exon

Literature and cross-references EcamPrx[P]188 (EcC052562.20)
Protein sequence: EcamPrx[P]188 (EcC052562.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   200
PWM (Da):   %s   21664.09  
PI (pH):   %s   9.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
EIGKALAVINYILVKTVSVKLSYTEIGWTKLATSARKKGFNHGKPKRG*YQPILILSDLITSFSNKGFTAQKMVALLGSHTIGEARSAMFKARLYNKSNMNSSVSVSLKADCPS*RGENISPHDVTSPNSFDNG*FWNLKSQKGLLHLDQQLLEGGSTDDHVTAYSINLGLF*NDFAAAMDKMGCLSPLTGSSSQIRMNCREV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing; stops in frame). Close to EcC054337.40 (Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGATCGGGAAAGCCTTGGCGGTAATTAATTATATCTTAGTCAAAACAGTTAGTGTCAAGCTGTCATACACGGAAAGTGCCTACAATAGTTGACATATACGTGCAATATATGTGCCATGT
ACGTGCAATATATGTGCTATCTTGAAAGATAAGGATAATTAACGTAAATATCATCAGGACATTGTTAGTATGACCATACAGTTATTTTAACCTAGTAACAGTGTAAGGGCAGCCACACAT
TTCACTTTAGACTGAAAGGGGACCCAATACAACCCAGAAACTATGCTTCCTCTTTTTCGTTTGCTTGATCGCATCAACCTCAGCCTCAACACAATTATCCGAGGAGAATTACTATGCAGT
AAAGTGCCCGAAGGCGCTCGATCGACACTGTGAGATCTACCGTGAAATCGGCGGTGGCCAACGAGGCTCGCATGAAAGCATCCTTGCTCCGTCTTCACTTTCATGACTGCTTTGTCAAGT
CTCTTTCGCTTTCTATCTCCGTTCTAATTTTGTCTTCTTCTTTTTTTCCCTTTGTATGGTATTCTCTTTTAATAAATGAAACGTTTCTCTTTTAACATTCCTTTCCGATTGCTTGTCAAA
AATATAAATATATTTTCTTACCTCATAAGTTCAATATTGAGATGATCCTCTCTGTCCATTTGATCTTGTAAACTTAATAAGATTAAAACTAACCAAACTAATTTTCAATTTCTTTTGTAG
GGATGTGATGTGTCCACTCTACTGGACGATACAGTGAACTTCACCGGAGAGAAGACGGCCTTCCCCAACACGAACTCCATGAGGGGATTCATCATGAATCAAGTCAGCATTGGAGAAGTG
ATGCCCCAGCGTTGTCTTGCGCCGACATCTTAGCCATTGCCCCTAAGAACTCCATCGTCGTAGTGAGACTGACCCTTGAAATTTCTTGAAACATATGAAGAAGCTATTATTTTTCCTAAA
CTATTGTGGATTCAATTAATTTGATGTTTAGTTGGGTGGACTAAATTGGCAACTTCAGCTCGAAAGAAGGGCTTCAACCACGGCAAGCCTAAACGCGGCTAATACCAACCAATTCTCATT
CTCAGCGATCTCATCACCTCTTTCTCCAACAAAGGGTTCACTGCCCAAAAAATGGTGGCACTCTTGGGATCCCACACCATAGGCGAAGCTAGGAGCGCAATGTTCAAGGCTCGGCTCTAC
AACAAGAGCAACATGAACTCGTCAGTGTCCGTGTCTTTGAAGGCCGATTGCCCCAGCTGAAGAGGCGAAAACATCTCCCCTCACGACGTCACGAGCCCTAACTCCTTTGACAACGGGTAA
TTTTGGAACTT
GTGAGCCGTGAGCCAAAAGGGCCTACTCCAACTCGGACCAACAATTGCTCAAGAGATGTTCAACAGACAATCATATGACCGCCTACCGCGACAATTTGGGTTTATTTTA
AAACGATTTTGCTGTTGCCATGGACAAGACGGGTGGCCCTCTCACCTTATCTGGGAGGTCAATTGATTGCAAGCCTGGCGACTCGTGTTCATTCTATGATGTTTTTCCTCCTTTGCTACT
TATTGAGAGTTAAGCGTCTTCTAATTTTCCTTTGGGTTAGTGTTTTAAGTGAATTGCAGAGGCGTGATGATAGTTCGATAAAGTTGTGAGGCTTCCTGAGAAAACCGGGGAGACAGAGTA
CACTGGAACCAAACCGAGCAAAACAGGAGGAAGAAGAAGGCCAACGAGCTCGCTCTCGCCCGCCCATGGAAGCACGGTTCCTAATGCCTCGTCCCCTGCATTTATACTCCCCAGGCGCGC
TCAAAGCTCCCGACTTGACCGCCACCACCACCACCACCCATCATCGAAGCAACTCCACCGTCATATTGCCAAATCTCTCATCGGAAGAGCTAATACGTGCAATGTACGTGCCATGTACGT
GCAATGTATATGCCATGTACGTGCAAGATACGTGCAATCTTGAAAGATAAGGATAATTAATGTAAATATCATCAGGACATAGTTAGTATAACCATACAGTTATTTTAACCTAGTAACGGT
GCAAGGGCAGCCACACATTTCACTTTAGATGGAAAGGGGACCCAATACAACCCAGAAACTGTGCTTCCTCTTTTTCATTTGCTTGATCGCATCGACGTCCGCCTCAACACAATTGTTCGA
GGAGAATTACTATGCAGCAAAGTGCCCGATGGCGCTTGAGACTGTGAGATCTGCTGTGAAATCAGCAGTAGCCAACGAGGCTTGCATGAAAGCATCCTTGCTCCATCTTCACTTTCATGA
CTGCTTTGTCAATGTAAGTCTCTCCCCTCGCAACGTCACGAGCCCTACATATCCTTTGACAACGGCTAATTCTGGAAGAGCCAAAAGGGCCTACTCCACCTGGACCAACAATTGCTCGAG
GGAGGTTCAACAGACGATCATGTGACCGCCTATAGCATTAATTTGGGTTTATTCTAAAACGATTTTGCTGCTGCCATGGACAAGATGGGATGCCTTAGCCCTCTCACTGGGTCTAGCAGT
CAGATAAGGATGAATTGCAGGGAGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGATCGGGAAAGCCTTGGCGGTAATTAATTATATCTTAGTCAAAACAGTTAGTGTCAAGCTGTCATACACGGAAATTGGGTGGACTAAATTGGCAACTTCAGCTCGAAAGAAGGGCTTC
AACCACGGCAAGCCTAAACGCGGCTAATACCAACCAATTCTCATTCTCAGCGATCTCATCACCTCTTTCTCCAACAAAGGGTTCACTGCCCAAAAAATGGTGGCACTCTTGGGATCCCAC
ACCATAGGCGAAGCTAGGAGCGCAATGTTCAAGGCTCGGCTCTACAACAAGAGCAACATGAACTCGTCAGTGTCCGTGTCTTTGAAGGCCGATTGCCCCAGCTGAAGAGGCGAAAACATC
TCCCCTCACGACGTCACGAGCCCTAACTCCTTTGACAACGGGTAATTTTGGAACTT
GAAGAGCCAAAAGGGCCTACTCCACCTGGACCAACAATTGCTCGAGGGAGGTTCAACAGACGAT
CATGTGACCGCCTATAGCATTAATTTGGGTTTATTCTAAAACGATTTTGCTGCTGCCATGGACAAGATGGGATGCCTTAGCCCTCTCACTGGGTCTAGCAGTCAGATAAGGATGAATTGC
AGGGAGGTTAAT

Retrieve as FASTA