Entry information : EcamPrx[P]159 ( EcC052984.10)
Entry ID 10436
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-05-23 (Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EcamPrx[P]159 ( EcC052984.10)
Name (synonym) EcamPrx[P]159 ( EcC052984.10)
Class Class III peroxidase     [Orthogroup: Prx007]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]159
start..stop
S start..stop
EgrPrx[P]159 441 1e-159 1..246 2..238
EguPrx[P]159 414 3e-149 1..246 2..240
EgrPrx[P]160 389 6e-139 1..222 2..240
EguPrx[P]160 388 1e-138 1..222 2..240
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..191 191 N° 2 304..850 547  
join(1..191,304..850)


exon

Literature and cross-references EcamPrx[P]159 ( EcC052984.10)
Protein sequence: EcamPrx[P]159 ( EcC052984.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246
PWM (Da):   %s   26382  
PI (pH):   %s   4.47
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCNASVLRDGSASEPSEQDTPPNRNLRCTVLQIxDLCDLVEKKCGRVVSCADIATIAAQDSIFLSGRPEYDVPLGRRDGLAFASVNKTTENLPSPTQSASQILAALAKKSFDATDVMTLSGAHTIELGHCGSFTNRLYPTPDPTMEKSFARACxPTTNSTNTIVLDIQSPNWFTSDKDQYEDPTTRDIVTSFAKDLELFFERFVLAMTKMGQLGLLTGTKGExPSPLLGQEFLEMLFPDDPKYLCP

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from kazusa (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATGCAATGCTTCGGTGTTGCGGGATGGATCAGCGAGTGAACCGAGCGAGCAGGACACCCCACCGAATCGAAACTTGAGATGCACAGTGTTGCAAATCATNGACCTCTGCGACCTCGTG
GAGAAGAAATGTGGTCGGGTAGTCTCTTGTGCTGACATCGCCACCATCGCCGCTCAAGATTCCATTTTCTT
GGTAAACCCCCTTCAGCCTGTTTTGATTATAAGCTTTATGTTCTTTCAA
GTTGGATTTCTTTATCGGGGATTAATTGTAAATAATGTGACCATGCATAATATACCGTGTGCAGTCAGGCAGACCTGAGTATGACGTGCCATTGGGAAGGCGGGACGGACTCGCTTTTGC
GTCTGTAAACAAGACCACAGAGAATTTACCTTCACCAACTCAGAGCGCTAGCCAAATTCTCGCTGCCCTAGCCAAGAAAAGCTTCGACGCCACCGATGTAATGACACTCTCTGGAGCCCA
CACCATCGAGCTTGGGCACTGCGGCAGTTTCACCAACCGGCTCTACCCGACCCCAGACCCCACCATGGAGAAAAGCTTCGCCCGTGCATGTGCNCCCACTACAAACTCCACGAACACCAT
AGTCCTGGACATCCAATCGCCCAACTGGTTCACGTCGGACAAAGATCAATATGAGGACCCCACAACGAGGGACATCGTTACTAGCTTTGCCAAGGACCTGGAATTGTTCTTCGAGAGGTT
TGTTCTCGCTATGACCAAGATGGGGCAGCTTGGCTTGTTGACTGGGACGAAAGGAGAAATNCCAAGCCCGCTGCTCGGTCAGGAATTCCTAGAAATGCTTTTTCCTGATGACCCCAAATA
TTTATGTCCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATGCAATGCTTCGGTGTTGCGGGATGGATCAGCGAGTGAACCGAGCGAGCAGGACACCCCACCGAATCGAAACTTGAGATGCACAGTGTTGCAAATCATNGACCTCTGCGACCTCGTG
GAGAAGAAATGTGGTCGGGTAGTCTCTTGTGCTGACATCGCCACCATCGCCGCTCAAGATTCCATTTTCTT
GTCAGGCAGACCTGAGTATGACGTGCCATTGGGAAGGCGGGACGGACTC
GCTTTTGCGTCTGTAAACAAGACCACAGAGAATTTACCTTCACCAACTCAGAGCGCTAGCCAAATTCTCGCTGCCCTAGCCAAGAAAAGCTTCGACGCCACCGATGTAATGACACTCTCT
GGAGCCCACACCATCGAGCTTGGGCACTGCGGCAGTTTCACCAACCGGCTCTACCCGACCCCAGACCCCACCATGGAGAAAAGCTTCGCCCGTGCATGTGCNCCCACTACAAACTCCACG
AACACCATAGTCCTGGACATCCAATCGCCCAACTGGTTCACGTCGGACAAAGATCAATATGAGGACCCCACAACGAGGGACATCGTTACTAGCTTTGCCAAGGACCTGGAATTGTTCTTC
GAGAGGTTTGTTCTCGCTATGACCAAGATGGGGCAGCTTGGCTTGTTGACTGGGACGAAAGGAGAAATNCCAAGCCCGCTGCTCGGTCAGGAATTCCTAGAAATGCTTTTTCCTGATGAC
CCCAAATATTTATGTCCT

Retrieve as FASTA