Entry information : EcamPrx[P]189 (EcS635745.10)
Entry ID 10441
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-05-19 (Christophe Dunand)
Peroxidase information: EcamPrx[P]189 (EcS635745.10)
Name (synonym) EcamPrx[P]189 (EcS635745.10)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]189
start..stop
S start..stop
EglPrx167 157 2e-49 2..164 49..222
EgrPrx25 157 2e-48 1..164 145..319
EgrPrx[P]168 155 3e-48 2..164 77..250
EglPrx25 157 3e-48 1..164 145..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..212 212 N° 2 237..411 175 N° 3 436..489 54 N° 4 529..573 45
join(1..212,237..411,436..489,529..573)


exon

Literature and cross-references EcamPrx[P]189 (EcS635745.10)
Protein sequence: EcamPrx[P]189 (EcS635745.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   17575.57  
PI (pH):   %s   7.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LVGRENLSTTSLSAANTDIPAPTLNFNDLITSFSYRGFTAKEMVELWGSHTIGAQLSNPSSTMRAT*TCRSPxxTQEATTTPPDIMSLMSFDNSYFHNLVSQKGLLHLDLQLFSGNSTNDQGGDSTNDQVTLWSNFASAMVKMGRLSPLTRSRSRIRMNCREVN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing; stops in frame; PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAGTAGGAAGAGAAAATTTGTCCACGACGAGCCTAAGTGCTGCTAATACTGATATCCCAGCTCCAACTCTTAATTTCAATGACCTCATCACCTCTTTCTCCTACAGAGGTTTCACTGCC
AAAGAAATGGTAGAACTCTGGGGATCCCACACCATAGGTGCACAATTATCCAATCCCAGCTCTACCATGAGAGCAACATAAACTTGTCGTTC
GCCACGTCTTTAAAGGCCGATTGCCCCA
NNNNNNACTCAGGAGGCCACAACAACTCCCCCCGACATCATGAGCCTTATGTCCTTCGACAATAGCTACTTCCACAATTTGGTGAGCCAAAAGGGTCTACTCCACTTGGACCTGCAGTTG
TTCAGTGGGAATTCAACGAATGATCAAGGTGGGGATTCAACGAACGATCAA
GTGACCATCTAAAACAACATTTTGAATTTGTTATGGAGCAACTTTGCTAGTGCCATGGTCAAGATGGGA
CGCCTTAGC
CCTCTCGCTGTGTTTTTTATTTTTTATTTATTGGTCGGACCTCTCACTAGGTCTCGCAGTCGGATAAGAATGAATTGCAGGGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTAGTAGGAAGAGAAAATTTGTCCACGACGAGCCTAAGTGCTGCTAATACTGATATCCCAGCTCCAACTCTTAATTTCAATGACCTCATCACCTCTTTCTCCTACAGAGGTTTCACTGCC
AAAGAAATGGTAGAACTCTGGGGATCCCACACCATAGGTGCACAATTATCCAATCCCAGCTCTACCATGAGAGCAACATAAACTTGTCGTTC
CCCANNNNNNACTCAGGAGGCCACAACA
ACTCCCCCCGACATCATGAGCCTTATGTCCTTCGACAATAGCTACTTCCACAATTTGGTGAGCCAAAAGGGTCTACTCCACTTGGACCTGCAGTTGTTCAGTGGGAATTCAACGAATGAT
CAAGGTGGGGATTCAACGAACGATCAA
AATTTGTTATGGAGCAACTTTGCTAGTGCCATGGTCAAGATGGGACGCCTTAGCCCTCTCACTAGGTCTCGCAGTCGGATAAGAATGAATTGC
AGGGAG

Retrieve as FASTA