Entry information : EcamPrx[P]06 (EcC012499.40)
Entry ID 10445
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-05-16 (Qiang Li)
Peroxidase information: EcamPrx[P]06 (EcC012499.40)
Name (synonym) EcamPrx[P]06 (EcC012499.40)
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]06
start..stop
S start..stop
EgrPrx[P]11 433 2e-154 1..288 1..327
EgrPrx[P]06 421 2e-149 1..288 1..332
EglPrx[P]06 365 8e-128 1..288 1..307
EguPrx12 345 1e-119 1..288 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..270 270 N° 2 478..581 104 N° 3 1593..1670 78 N° 4 3713..4123 411
join(1..270,478..581,1593..1670,3713..4123)


exon

Literature and cross-references EcamPrx[P]06 (EcC012499.40)
Protein sequence: EcamPrx[P]06 (EcC012499.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287 (268)
PWM (Da):   %s   32207.13 (30140.0)  
PI (pH):   %s   7.69 (7.38) Peptide Signal:   %s   cut: 20 range:20-287
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPSRLWQLLLSALALVSSCQVQHNANAAETMDPPQKLQWLYYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIQLLYSDCFVTVCIACFLMEMIDKVKEVLEQHCPRDVSCTxIINLAAKDAVVLVGGTSYPIPMGRRDENSSSAKSVDLPGGAFTGQDQLQLHPGQVVRFQQNWRARPKHGPNLLAQLREQCPPNSTNLAYLNPDLGSSYSFGKSFYSRVRHHQAVLGINQQIASNFDSSLIAWEYDLRFGDLQKMFGTSTIRMGNIKLPPEDQG*IRKNCQVVDRK

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (stops in frame; PS is missing). Close to (EcC012499.30, Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing; stop in frame))
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACCATCTAGGTTGTGGCAGTTGTTGCTATCGGCGCTCGCGTTGGTGAGCTCATGCCAGGTGCAGCACAATGCCAACGCGGCAGAGACAATGGATCCGCCGCAGAAGCTGCAATGG
CTTTACTACCAGAACTCATGCCCTGACGCTGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTTGCTCCCAAGCTCATTCAACTACTCTACTCCGACTGC
TTCGTCACCGTATGTATCGCCTGCTTTCTT
TTCCTCTCTTGGATGATCTTGAAATCCGTATCGCTTCAATATTAAGTTTCCATCTCCCTTCTATGCACTTGATATCATTTCACCTAACAA
TTTAAACCTCTCGAACTAGGCTTTCTAACGTACCACTCTTTTGTGTATAAAACTGGGGTGCAATGCGTCAATTCTATTGGACGGGTCTATTCAGAATGCAGCGCTTCTAGGCTTCCTATG
GAGATGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCAGGGACGTCTCTTGCACGACNATAATCAACCTCGCTGCTAAAGATGCTGTTGTCTT
GGTATGCAACATGGTTCGC
AGTTTTTCCCTTTTGGGCTTGAAAAAATATAGTTTAGGCTGCTCCACTAATAATTGACATTGTGCGTTTGGTTCAGCATTTCCAAGGGGCTTTCAGCCCTAAAAGCCTCTTGGGGAAATG
CTGGACCGTTTGATTCAATTTTTTTGATGGCCTTCAACTTTCAACTTACCTTCAAAATGTTGAAGGCCCAAAGCTAGTAGAGACTAGCTTTTGGGCTTTTAGCATTTAGTGGAATGCTAA
AATTATTTTTTATCTTCCAAAACTACCCTCACTAATTTTTCATATTTTCGATTTTGCCCCTATTTATTTCTTATTTTTAATTGAAAAAGGAGGCAGCCCTTCACCAGACCGATGAAGGGC
TACGGCCACTGTCAAGCCAGATCTGGCACCGACGGCCGTTGACTAAGGTCACCTGAGGTCAGGCAACCTTCAACGAGGGTTGTGTGACCCAACTGAGGGCCGCGAGACTCAGGCGACGGT
CGCCTGGGTCACGCAACCCTCGTCGAGGGTCGCTTGACCTCGAGCGACCTCTGGCAGCCCTCGGCTAGGTCACACGACCCTCGCCGAGGGTAGCCTGAGGTCGGGAGACCTCCGGCGGCC
CTCAGCTGGGTCGTGCAACCCTTGCTAAAGGTCACCCAAGGTCGGGCGACCTTAGCTGACGGCTGGCGGCAGCCGTAGCCCTTCCCCGGTTTGACGAAAGGTTTAGTTTAATTTTCAAAA
ATAAAAATAAAAATATATATAATTATATACCCATCAAAGCTCATTGCGAAAGTTTTCTTTACTAAACGCACATTCAACTTAAAGACCATTTGCAAAAAAAATTTACCAAACACAATTGTA
TTTCTCCAAGTAGATTTGGGCTTTCAACATTTGCATTTAACTCAAAACCCATTGCAAATGCTGAACCAAACGCAGCCGCTGTCAGCTTGAGTTCTAGAGCGTTTGATATGGAGAAAAATT
AGAATTACTAATGCGATAATGATGCTGTAACAGGTGGGAGGGACGTCGTACCCCATTCCAATGGGGAGGAGGGACGAGAATTCATCCTCCGCGAAGTCGGTGGACCTCCCATTTATGCCC
TATTTGGTAATGGGTTAAATAGTAAAAAATTTTATTCTTTTGTTCCGGGGAATAGTTTTGGAACAGAATCGTGTTTAGTAAAAATTTTGTTCCTGGAAATAAATTTTTATTTTTTTGTTC
ATGGAAGTAGATTTGGAATATAATCAAGAAAAAAAAAGTTGATTCTTCTTTCCAAGAACAATTCTAGAATTAAGTTCATATTTTCTCTTTTTATTTTATTTTTCTTTGTTCTTCTTCCAT
TTTCTTCTTCTTCATCTATTGCCACCGCTGCCATTGCCGTCCGCCACCCACCATTGCCGGTTGACGACAACTAGTTCGGCGAGGCGGGTGAGGCTCGCCCAACCCTGGTGAGGCTTAGCC
AGCCCTGGCCAGGCTCAACCGAGCTCACCCAGCCGTTGACGGGGCTCGACCTCGCCAAGCCATCGCGAGGTCGGCCTCACCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNGAATAGGAAAAAAGAAGAGGGAAAAAGTAAAAAAGTAATAACATTATTAAAATTTTAAAAGAAAATGATTTAGAGTAGGAATTCTGAGTACAGCAC
CAAATGCAATTCTATTTCGGGAATTGAAATTTTGGACAATTACCAAACAACTTAAAATACTTAAAAATTGTTCCCGGGAACAAAATAAAAAAAGAATCAATTCTGATAAGAAATTGTTCC
TGAGAACAAAAGCGTTACCAGACACACCCTTAGAGTGGTGGGTCTTAGACCCATATATGACCCATTTAAATCATAAATGGGTCATATATGGATCACTTATTTTTTGAAGAAACTAGTTAA
ATGGATTTAAAAATTGAAGACTTAAGATAAATTGGTTTTAATTTTTAAATGGGTCTTAAACGGCTTGGAATTAGAACCCATTTTCAACCAAAACCTCACAATCTCCATCTTCCCTCTTTA
ACTTTATGAAATTATTCTTAAACAAAGATCAAAATTATAATTATTTTTTATATTTTAATTTTCTTTTTTCTTTCCTTCTTCCTCTTTCTTTAGTTGATGGCCAAGTGAGGCTTGAGCTCA
CTGGCCTTAGGCGTGGCTCAAGCCTCGCCAGATCCAGCAATGGGCGAGCTCGAGCCTCACCGATCTAGCGAGCCTCGAGTGAGCCAGATGAGCTCAAGGCTTGCCTGTGGCTGGTAGCCA
GCTATCGTCATGGTCAACAACCGGCCATAAAAGAAGAAAAACAAAAAACAAAAAAGAAAAGGAAAATAAAAAATTATATTCTTAAAAAATATGAAAATTGTCCATTAAATTTATATTGGA
TAAAATTATTTTAGCAATACCATTTTAAAAAAAAATGATAAGAAATAAGTTTTCTTAAGTTTAGTTAAATTGGTCGGATATGATTGGGTCGGGTATGGGTAAAAAACTTTGCACTACAAT
AAATCGGTCATAAACGGGTTAAATGGATCGAATTGAGTCAAACAATTTATGACCCAACCCACCAATTTAACGGATCTACTTCCATTGCAGGGCGTCTTGTGGAAAGCGGAGCCCGGTTAC
TTCAAATCAAAGGGTTTGAATGTGCTAGTCCTCACTGCTCTACGCGGCGTCATCTAACCCTCACAAATTTGACCGGGACCTCATTATATCACCTTACATCTTAACCAATCCAGGCAAATC
GTTTAGTTTAGTGGATCGCAACGTCTTTTTTTTGCTTTTAAGTTTTGTAAGTCGCTGCCTAATTGTCACGATTCAAAGAATATTATCAGATACAGTATTGTCGAGGATATAATCTGAGCC
CCAATCCTCACAATGATCTCCTCCCAGTTCACAAAATGGAAATGCTCACGTATTATGTCAATCTCAGAATCATAGCCAAAATCCTAACTTGCCGAAACAATTTAAATTTTTCCGGGGGGG
CATTCACTGGGCAAGACCAGTTGCAGCTTCATCCCGGACAGGTTGTACGATTTCAACAAAACTGGCGAGCCAGACCCAAGCATGGACCCAACCTTCTTGCCCAATTGAGGGAGCAATGCC
CTCCGAACTCAACGAATCTAGCGTACCTCAACCCTGACTTAGGCTCGAGCTACAGCTTCGGCAAGTCCTTCTACTCAAGGGTACGGCACCACCAGGCGGTCCTCGGCATCAACCAGCAGA
TCGCTAGCAACTTCGACAGCTCCCTGATCGCTTGGGAGTATGATCTCAGATTTGGGGACCTCCAGAAGATGTTCGGCACGTCAACAATCCGGATGGGGAACATCAAGCTCCCACCGGAGG
ATCAGGGGTAGATTCGCAAGAATTGCCAAGTCGTGGACAGGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACCATCTAGGTTGTGGCAGTTGTTGCTATCGGCGCTCGCGTTGGTGAGCTCATGCCAGGTGCAGCACAATGCCAACGCGGCAGAGACAATGGATCCGCCGCAGAAGCTGCAATGG
CTTTACTACCAGAACTCATGCCCTGACGCTGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTTGCTCCCAAGCTCATTCAACTACTCTACTCCGACTGC
TTCGTCACCGTATGTATCGCCTGCTTTCTT
ATGGAGATGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCAGGGACGTCTCTTGCACGACNATAATCAACCTCGCTGCTAAA
GATGCTGTTGTCTT
GGTGGGAGGGACGTCGTACCCCATTCCAATGGGGAGGAGGGACGAGAATTCATCCTCCGCGAAGTCGGTGGACCTCCCCGGGGGGGCATTCACTGGGCAAGACCAG
TTGCAGCTTCATCCCGGACAGGTTGTACGATTTCAACAAAACTGGCGAGCCAGACCCAAGCATGGACCCAACCTTCTTGCCCAATTGAGGGAGCAATGCCCTCCGAACTCAACGAATCTA
GCGTACCTCAACCCTGACTTAGGCTCGAGCTACAGCTTCGGCAAGTCCTTCTACTCAAGGGTACGGCACCACCAGGCGGTCCTCGGCATCAACCAGCAGATCGCTAGCAACTTCGACAGC
TCCCTGATCGCTTGGGAGTATGATCTCAGATTTGGGGACCTCCAGAAGATGTTCGGCACGTCAACAATCCGGATGGGGAACATCAAGCTCCCACCGGAGGATCAGGGGTAGATTCGCAAG
AATTGCCAAGTCGTGGACAGGAA

Retrieve as FASTA