Entry information : EcamPrx[P]10 ( EcC012499.50)
Entry ID 10447
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-06 (Christophe Dunand)
Peroxidase information: EcamPrx[P]10 ( EcC012499.50)
Name (synonym) EcamPrx[P]10 ( EcC012499.50)
Class Class III peroxidase     [Orthogroup: Prx092]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]10
start..stop
S start..stop
EglPrx[P]10 597 0 10..336 1..327
EgrPrx[P]10 563 0 32..336 4..307
EgrPrx08 511 0 1..336 1..337
EgrPrx09 510 0 1..336 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..248 248 N° 2 451..636 186 N° 3 778..936 159 N° 4 1217..1626 410
join(1..248,451..636,778..936,1217..1626)


exon

Literature and cross-references EcamPrx[P]10 ( EcC012499.50)
Protein sequence: EcamPrx[P]10 ( EcC012499.50)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (307)
PWM (Da):   %s   36649.25 (33696.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.19 (7.36) Peptide Signal:   %s   cut: 28 range:28-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASRWWL*LSLAALALVSSSAVWRV*AAVxIEPPQKLQWHYYRNSCRDAERYVSTQVEFYWKLDRSLASKPIRMLYADCFVTGCDALILSDRPYSEKTAPQNADLLGFPMAVMDKIKQVLEQHCPGVVCCADILNFAARDAAHLAGGLSYPFLAGRRDGMSSSVASVDLPLGAxPWGSVLAYFESRGLDVLDLVTLLGGxHSMGKTSCSFIADRLYNFNKIGKPDPSMDSSFLAQMREQGPPNSKNQVYLDPDSGSSYSFSKSFYSGVLNHRVVLGIDQQITANNDSSQIAEEFNASFEDFRKMFALSMSRMGNIKVLPWKQGEIRKNCRVVNGK

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Kazusa (stops in frame). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTAGTTGTCGCTGGCGGCGCTTGCGTTGGTGAGCTCGTCTGCCGTGTGGCGTGTCTAGGCGGCAGTGGCNATTGAGCCGCCACAGAAGCTGCAGTGG
CATTACTACCGGAACTCGTGCCGCGACGCCGAGAGGTACGTTAGCACCCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTCGCGTCCAAGCCCATCCGAATGCTCTATGCCGATTGC
TTCGTCAC
GGTACATTTCTTATCCTCTCTCGAACGATCTATCAGTCCGCATCACTTCAATAACAAGTTTTCATCGCCCTTCTAAGCACGTGATATCCTTTCACCCAACGGTTTAACCTCT
TGAACCAGGCTTTCTTACATACCACTCTTGTGTACGTATATATAAAACAAAGCCTTGGACTCAGATATGTTTGGTTATGCATACAAAACAGGGGTGCGATGCGTTGATTCTATCAGACCG
GCCATATTCAGAGAAAACAGCACCGCAAAATGCAGATCTTCTAGGGTTTCCTATGGCGGTGATGGACAAGATCAAGCAAGTCCTGGAACAACATTGTCCAGGAGTCGTCTGTTGTGCTGA
CATACTCAACTTTGCCGCTAGAGATGCTGCTCACTT
GGTATGTACCTGGTTTGCACTTCTCTCTTTTGGCTTGAAAAGACGTTTTCGCTGCACTGGTTATTGACATGCTGTTAGCTTGAG
CTTGTAGGGTTAGATGTGGAAAATTAGCAGTGCTGATGTGATAATAATGTTGAAATAGGCGGGAGGGCTGTCGTACCCTTTTCTAGCGGGGAGGAGGGACGGGATGTCGTCCTCCGTGGC
GTCGGTGGACCTCCCATTGGGGGCCACNCCTTGGGGATCGGTGCTCGCTTACTTCGAATCAAGAGGCTTGGATGTGCTGGATCTTGTTACTCTACT
CGGTACGATCGACCCTCATGTGAA
AACGTATTTATTTGACTTGTGACCTCATTAAATTACCTTAGATCTTAGCAATTCCTTTTCGAATTTAATTTTTCGAAATCTCCATCTAATTGTTGGGATACATAGAGTTTTATCATATAT
AGGATAGTCGAGAATATAATCCGAACTGATCCTCCTAATGATACCTCCAAGTGCACGAAGCAACATGTTTATGTACTATGTCATATCTCAAAATCAGAACCAATTCCTAACTTGCCAAAA
CAATGTAAACTTTGCAAGGAGGGNNNCATTCAATGGGCAAGACCAGCTGCAGCTTCATCGCGGACCGGCTGTACAATTTCAACAAAATTGGCAAGCCAGACCCAAGCATGGACTCATCCT
TCTTGGCCCAGATGAGGGAGCAAGGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGATTCAGGTTCCAGCTACAGCTTCAGCAAGTCATTCTACTCCGGGGTCCTGAACCACC
GTGTCGTCCTCGGCATCGACCAGCAGATCACCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTTCAATGCCAGTTTTGAGGACTTCCGGAAGATGTTCGCCCTATCGATGAGCCGGA
TGGGGAACATCAAGGTCTTGCCGTGGAAGCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAAGGTGGTGGTTGTAGTTGTCGCTGGCGGCGCTTGCGTTGGTGAGCTCGTCTGCCGTGTGGCGTGTCTAGGCGGCAGTGGCNATTGAGCCGCCACAGAAGCTGCAGTGG
CATTACTACCGGAACTCGTGCCGCGACGCCGAGAGGTACGTTAGCACCCAGGTCGAGTTCTACTGGAAGCTGGACAGGAGCCTCGCGTCCAAGCCCATCCGAATGCTCTATGCCGATTGC
TTCGTCAC
GGGGTGCGATGCGTTGATTCTATCAGACCGGCCATATTCAGAGAAAACAGCACCGCAAAATGCAGATCTTCTAGGGTTTCCTATGGCGGTGATGGACAAGATCAAGCAAGTC
CTGGAACAACATTGTCCAGGAGTCGTCTGTTGTGCTGACATACTCAACTTTGCCGCTAGAGATGCTGCTCACTT
GGCGGGAGGGCTGTCGTACCCTTTTCTAGCGGGGAGGAGGGACGGG
ATGTCGTCCTCCGTGGCGTCGGTGGACCTCCCATTGGGGGCCACNCCTTGGGGATCGGTGCTCGCTTACTTCGAATCAAGAGGCTTGGATGTGCTGGATCTTGTTACTCTACT
AGGAGGG
NNNCATTCAATGGGCAAGACCAGCTGCAGCTTCATCGCGGACCGGCTGTACAATTTCAACAAAATTGGCAAGCCAGACCCAAGCATGGACTCATCCTTCTTGGCCCAGATGAGGGAGCAA
GGCCCACCGAACTCAAAGAATCAAGTGTACCTTGACCCTGATTCAGGTTCCAGCTACAGCTTCAGCAAGTCATTCTACTCCGGGGTCCTGAACCACCGTGTCGTCCTCGGCATCGACCAG
CAGATCACCGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTTCAATGCCAGTTTTGAGGACTTCCGGAAGATGTTCGCCCTATCGATGAGCCGGATGGGGAACATCAAGGTCTTGCCG
TGGAAGCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACG

Retrieve as FASTA