Entry information : EcamPrx[P]57 ( EcC021894.30)
Entry ID 10454
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EcamPrx[P]57 ( EcC021894.30)
Name (synonym) EcamPrx[P]57 ( EcC021894.30)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]57
start..stop
S start..stop
EgrPrx[P]57 262 4e-91 1..164 1..153
EguPrx[P]57 254 7e-88 1..164 1..153
EglPrx176 211 7e-70 1..164 1..230
EcamPrx176 212 1e-69 18..164 64..262
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..72 72 N° 2 134..337 204 N° 3 1646..1861 216  
join(1..72,134..337,1646..1861)


exon

Literature and cross-references EcamPrx[P]57 ( EcC021894.30)
Protein sequence: EcamPrx[P]57 ( EcC021894.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17983.31 Transmb domain:   %s   i13-35o
PI (pH):   %s   8.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPRLH*ERTFVRRIISLLHIIATWV*GYNGLILLDLTAYNKVEKAAVPNQSLTGFDVIDEIKEKLEETCPLVVSCVDILILGARDSVSIQVRSGRHTIGVGHCNFFSNRLYNFTSKGDQDLSLDPTYASQLKAQRKTHSNNVTTLAMDPGSPLSFNSHYYTALN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Kazusa (Stops in frame; PS is missing; 3' end is missing due to NNNNNNN).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTAGATTGCACTGAGAACGCACATTCGTTAGAAGAATCATTTCATTGCTCCATATCATTGCCACATGGTTGTAGAAAGAGAGTTTCGCATGGTAATGTTTCATCGGTGTTTGATCG
GATCGCTTCATGTGTGTAGGGTTACAATGGCTTGATTTTGCTAGATTTGACGGCATACAACAAGGTGGAGAAGGCGGCAGTTCCGAACCAGTCGCTAACTGGGTTTGATGTAATAGACGA
GATCAAGGAGAAGCTAGAGGAAACATGCCCCCTCGTCGTCTCTTGTGTTGACATCCTCATTTTAGGTGCTCGAGACTCGGTCTCTATCCAAGTAAGA
CTTTTCGAGGCGATGAAAACTCT
TGGACCATTCATTGGCATTCTTTTGAGTGTGTTTCAACACTTTTGAAAGCTTTTCTTTTTCGAGTTAGTAGAACTTTAGTAACCTCGTCGACCCTCCTCGACATGTGCTCTTGAACAAAA
CTATTGTGGAAAAAAGCTTGTTTGGAGCATTCCATGGCGACACTAGACTATCAAGCAAAAATTCATCTGTCTTCTTTTGATACGATTTTCGACCACACAAATGCGTCAAAGTCAACCGTA
TTTTGATTCGTGATCAATCCATAGACCATAAAAACTACATAGNNNNNNNNNNNNNNNNNNNNCTTGATGACAGTAGGAATCGGTGGTGATGTGGGCAGAGCCCTCAACTTGCCTCCAACT
GTTCTATCTTCTTTGTCTTTCCTCTTTTTTTTTTTTTTGTAAAAAAAAGTCGTTTTATATTTAATTTAATGAATTTTTATATTAAAATTCAAATCCACGCCAAAATGATGTCGTTTTTGT
ATTTCTTTGCTAAGTCAGGTTTCTAGTGAGTCATACAAGCGAGCAAGATTAATAAAAATTACCACATAAGATTTTCTACGAGGTTCGTTAGAGGTGATATTTAAGTGTCCCATTTTTTTT
TTTTATTTAAAATGACACTTACACTTAAGTGTCACTTTCCACCTTACCAAAATTTTTTTACCTTACCAAAAAAAAATAAAAAAAGTGTCACTTTCCTAACTTTTGACAGTTAAGTGTTAT
TTTATGTCAAGTTTTAGCATTTGGGCCGTACTTTTGCTCACAATAATAGTATTAGGTTGTCTCACTCAAATATATATAATGGAATATCCTTTTTTTTCCAAACAAACCAAAGTATAGCAT
TGAAGTCCGTGGTGAAATTATCCGCATTCTTTTTTATCTGGTGTAACGGAGTGTAAAGACAAAGAATTCTTTTATTTAGTTACTTCACAAATAAGTTACTATCCTAACGATACGATCATT
GTCAACTAATAACGATGTAAGTCGGACCCCACTTTTTATATTATATAGGATGGGCAACCAGAGCACAGTATTCGTAATTTCAATATTTCCTATTTATATAGATTTTGGTTTCCCAATGAG
AGAAACATAGCATGTTGACATTACAAGTGAAAAAAAAAAAGAAGAACACTTCATCAAAAACACCCAAGCTTTCTCGATTTGAACAAGACACAGACTTGGACATTCACTTGACATTACACG
AAGACAAACTAACGACTAATCAAAATAAGAAGAGCAGTTGAATTAATTAGTTAATTAATTAAGTATAAACTACATTTCTGGGTCATCAGGTAGGCACACAATTGGGGTCGGGCACTGCAA
CTTCTTCAGCAACCGGCTCTACAACTTTACCAGCAAAGGCGACCAAGACCTTTCCCTCGACCCGACCTACGCCTCTCAATTGAAGGCCCAGCGCAAGACGCACTCCAATAACGTCACCAC
CCTCGCGATGGACCCCGGAAGCCCCCTCTCCTTCAACAGCCACTACTACACAGCCTTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTAGATTGCACTGAGAACGCACATTCGTTAGAAGAATCATTTCATTGCTCCATATCATTGCCACATGGGTGTAGGGTTACAATGGCTTGATTTTGCTAGATTTGACGGCATACAAC
AAGGTGGAGAAGGCGGCAGTTCCGAACCAGTCGCTAACTGGGTTTGATGTAATAGACGAGATCAAGGAGAAGCTAGAGGAAACATGCCCCCTCGTCGTCTCTTGTGTTGACATCCTCATT
TTAGGTGCTCGAGACTCGGTCTCTATCCAAGTAAGA
TCAGGTAGGCACACAATTGGGGTCGGGCACTGCAACTTCTTCAGCAACCGGCTCTACAACTTTACCAGCAAAGGCGACCAAGAC
CTTTCCCTCGACCCGACCTACGCCTCTCAATTGAAGGCCCAGCGCAAGACGCACTCCAATAACGTCACCACCCTCGCGATGGACCCCGGAAGCCCCCTCTCCTTCAACAGCCACTACTAC
ACAGCCTTGAAC

Retrieve as FASTA