Entry information : EcamPrx[P]46 ( EcC023248.20)
Entry ID 10457
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-07 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-23 (Christophe Dunand)
Peroxidase information: EcamPrx[P]46 ( EcC023248.20)
Name (synonym) EcamPrx[P]46 ( EcC023248.20)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]46
start..stop
S start..stop
EgrPrx[P]46 244 4e-82 40..170 183..313
EgrPrx[P]46 67 0.00000000000005 2..40 72..110
EcamPrx[P]42 234 4e-78 40..170 190..320
EcamPrx[P]42 79 2e-18 1..40 78..117
EguPrx[P]42 231 5e-77 40..171 185..316
EguPrx[P]42 75 1e-16 2..40 74..112
EguPrx[P]46 230 1e-76 40..170 183..313
EguPrx[P]46 74 1e-16 2..40 72..110
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3..123 121 N° 2 322..713 392  
join(3..123,322..713)


exon

Literature and cross-references EcamPrx[P]46 ( EcC023248.20)
Protein sequence: EcamPrx[P]46 ( EcC023248.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18772.4  
PI (pH):   %s   8.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CHGLILLEYTTNFAEKKNVSLNANSIRVFEVIDMIKSQLExCLLTRSHTIGQA*CLTFQAQLYNNLHRIYNITESKLSELRGRQQLLSS*RHEPDVLRHCLFKNLQTQEDLLNSD*QLFSGSAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSCSQIRKNYGKVNS

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (Undetermined residues due to NNNNNNN in DNA; 5' end is missing; Stop in frame). Close to EcC023248.30 (Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCCACGGGTTGATTTTATTGGAGTACACCACAAACTTCGCTGAGAAGAAGAATGTTAGCCTGAATGCCAATTCTATACGGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTAGAG
A
GCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTTGTTAACAAGATCGCACACGATAGGTCAAGCCTGA
TGCTTGACTTTCCAGGCCCAACTTTACAATAATCTACACCGCATATACAACATCACTGAAAGCAAACTGTCCGAGCTCCGTGGGCGACAACAACTCCTCTCCTCTTGACGCCACGAGCCC
GACGTCCTTCGACACTGCCTTTTCAAGAACTTGCAAACCCAAGAGGATCTTCTCAACTCGGACTAGCAATTGTTCAGTGGCAGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAAT
TCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGGCTCATGCAGTCAAATTAGGAAGAACTATGGAAAGGTCAACTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCCACGGGTTGATTTTATTGGAGTACACCACAAACTTCGCTGAGAAGAAGAATGTTAGCCTGAATGCCAATTCTATACGGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTAGAG
A
NNTGTTTGTTAACAAGATCGCACACGATAGGTCAAGCCTGATGCTTGACTTTCCAGGCCCAACTTTACAATAATCTACACCGCATATACAACATCACTGAAAGCAAACTGTCCGAGCTC
CGTGGGCGACAACAACTCCTCTCCTCTTGACGCCACGAGCCCGACGTCCTTCGACACTGCCTTTTCAAGAACTTGCAAACCCAAGAGGATCTTCTCAACTCGGACTAGCAATTGTTCAGT
GGCAGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGGCTCATGCAGT
CAAATTAGGAAGAACTATGGAAAGGTCAACTCA

Retrieve as FASTA