Entry information : EcamPrx[P]162 ( EcC029221.10)
Entry ID 10459
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EcamPrx[P]162 ( EcC029221.10)
Name (synonym) EcamPrx[P]162 ( EcC029221.10)
Class Class III peroxidase     [Orthogroup: Prx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]162
start..stop
S start..stop
EguPrx[P]162 525 0 7..296 1..290
EgrPrx[P]162 522 0 7..296 1..290
EgrPrx[P]164 514 0 7..295 1..291
EguPrx[P]164 503 0 7..295 1..291
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..209 209 N° 2 384..573 190 N° 3 2179..2340 162 N° 4 2496..2846 351
join(1..209,384..573,2179..2340,2496..2846)


exon

Literature and cross-references EcamPrx[P]162 ( EcC029221.10)
Protein sequence: EcamPrx[P]162 ( EcC029221.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   303 (280)
PWM (Da):   %s   32507.56 (30234.3)  
PI (pH):   %s   8.96 (8.72) Peptide Signal:   %s   cut: 24 range:24-303
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RLFGLGMGIVLGFLGNAAVSTQAQLEMGYYSKSCPEAEKIVRELSKxHIRNAHSLAAALLRTHVHDFFVGGCDASVLFNSS*SNPAERDSPPNFTMRGFDFIDRVKSLVEAEFPGIVSCADIIALAARDATVAGGPFWRVPTVRRYGVISRASEALSNIPSPSSKLNGPQIFFANKGVDLKDLVLSSGAHTFGASPCSSFRNHLYNFTGGEDQDPSLESGYAANLKAKKCRSLSNDTIFRSDSAITTGPASKLFITQVLQGSLDNFYAQFALAMEKMGRIDVKTGLAGEIRKHRALLNSQNQRE

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from kazusa (5' end is missing; stops in frame; PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGACTGTTTGGTTTGGGCATGGGCATTGTTTTGGGTTTTCTAGGGAATGCCGCTGTCTCAACTCAAGCTCAACTTGAGATGGGTTATTATTCTAAGAGCTGCCCAGAAGCTGAAAAAATT
GTGAGAGAGTTGTCGAAGATNCACATCCGCAATGCTCATTCTTTAGCAGCCGCTCTGCTGAGGACGCACGTTCATGATTTCTTTGTTGG
GGTTTTTACTTTCTCTCCCATGTAGCTTGCA
TCGGTGCACGTTAATATCTTACAGTAAACTTGAGAAATTTGGAGGAATCATTACTGCATATCTCCATTTCAAGAGTACTGGTATTTTCTTAATCTCATGCTAGCTTTGAGAAATTTGAGC
TCGTTGTTTGTTGATCACCGTCAGGGTTGTGATGCTTCTGTGCTCTTCAACTCTAGTTGAAGCAACCCAGCAGAGAGAGATTCTCCTCCAAACTTCACTATGAGAGGCTTTGACTTCATC
GATCGAGTGAAGAGCCTTGTCGAAGCTGAATTCCCGGGGATTGTCTCTTGCGCAGACATCATAGCTTTGGCCGCAAGAGATGCAACAGTGGCC
GCTATGAGGACAACAGCACAAAGATTA
TTTTCACGAAAGCCGATATCCATTGTCCAAGTGCGTCTGGATCTTAACACTATGTGAAAACTGTTTTCTCCACTGATGATCAAATGAGTATAGATTTGCAAGCGAAAAAAGCATTGAGAT
TGAGTGGGGAATTAAAACTGTATCTGATGTGCATGAAACTATAGGGAGGTCCATTTTGGAGAGTTCCTACGGTAAGAAGATATGGAGTAATTTCAAGGGCATCGGAAGCATTGAGCAACA
TCCCTTCTCCATCCAGCAAACTCAACGCTCCCCAAATATTTTTCGCCAATAAAGGAGTCGGTCTTAAAGACTTAGGGTGCGTTTGGTAACGATTCTATTCTCGGGAGTTGATTCTGACTA
GAAATGATTATTTTTTATTTTGTTTCTGGGAACTGATTCTGAGTAAAAAAACGCGTTTGGTAACTGTTCAAAATTTTTTATTCTAGAATAAAATTGCGTTTGATACCGTATTAATTGATT
CTGTTCCAAATTAATTTCTTTTAATTTTTAAATATTTTTTTTTACATTTTTCCCCTTTTTTTCCTATTCTTCTTCTTCTTCATTTGGCCGGTCGGCCGAGCCTCGTTGGCAGTTGGGCGA
GGCTTGCCCAGCCTCTCCGAGGCCGACCTCGCCCAGCCTTGGCGAGGCCAGCTTGGCCACCGGTGGGGCTGGGCAAGCCTCGTCGGTGGCCAGGCGAGCTTCACCGGCAGCTGGGCAAGG
CTCGACCTCGCCCGATCTGGTGAGGCCGAGCCTCGCCCAGCTGTCGGCGAGGCTCGCCCAGCCCCGCCGGTGGCCAGGTCGGCCTCACCGGGGTTGGGTGAGGCCGGCCTGGCCACTGGT
GAGGCTGGGCCTCGCCAGATCTGGCAAGGAAGAGCCTCGCCTGTGGCTGGGCTTGCCTTCGGCGAGCTCGCTGGACCTTGCCCTGGCCTGGCAAGCCTCCAGCGACTGGCGGTAGACGGC
GGCGGCGGCGGCGGGTGGCGGCGGATGGCAATCGGGATGACAAAAGGGAAGAGTGAGGGTGATTCTTTTTCTGATTCTTGGACGGAGAATCAAATTTTTTTTTTTATTCTCAAATCNNNN
NNNNNNNNNNNNNNNNAGGAATCATTACTGCATATCTCCATTTCAAGAGTACTGGTATTTTCTTAATCTCATGCTAGCTTTGAGAAATTTGAGCTCGTTGTTTGTTGATCACCGTCAGGG
TTGTGATGCTTCTGTGCTCTTCAACTCTAGTTGAAGCAACCCAGCAGAGAGAGATTCTCCTCCAAACTTCACTATGAGGGGCTTTGACTTCATCGATCGAGTGAAGAGCCTTGTCGAAGC
TGAATTCCCCGGGATTGTCTCTTGCGCAGACATCATAGCTTTGGCCGCAAGAGATGCAATAGTGGCCACTATGAGGACAACAGCACAAAGATTATTTCCACGAAAGCAGATATCCATTGT
CCAAGTGCGTCTAGATCTTAACACTATGTGAAAACAGTTTCCTCCACTGATGATCAAATGAGTATAGATTTGCAAGCGAAAAAAGCATTGAGATTGAGTGGGGAATTAAAACTGTATCTG
ATGTGCATGAAACTATAGGGAGGTCCATTTTGGAGAGTTCCTACGGTAAGAAGATATGGAGTAATTTCAAGGGCATCGGAAGCATTGAGCAACATCCCTTCTCCATCCAGCAAACTCAAC
GGTCCCCAAATATTTTTCGCCAATAAAGGAGTCGATCTTAAAGACTTAGTTTTATCTTCC
GGTGAGGCCATATGTCACCCACCTATAAAAATGAGAGGATATCAGTTGATGAGTTAAACC
ATTAGTATCGAGAGATATCGAAATGTATATTCAGTACGTGACTAAGCTGGTTATGCGCTAAATTAGTAGCGGCTGATGTGACTTGTTCTGATATAGGAGCTCACACATTTGGTGCATCTC
CCTGCTCGTCTTTCCGGAACCACCTATACAACTTCACTGGCGGTGAGGATCAAGACCCCTCCTTGGAAAGCGGGTACGCGGCGAATCTCAAGGCCAAGAAGTGCAGGAGCCTGAGTAACG
ATACCATCTTTCGATCGGATTCTGCTATCACTACCGGTCCTGCTTCCAAGCTCTTCATCACACAAGTCCTTCAAGGGTCACTTGACAACTTCTACGCTCAATTTGCCTTGGCAATGGAGA
AGATGGGCCGGATCGACGTGAAGACTGGGCTGGCAGGCGAGATAAGGAAGCATCGTGCGCTGTTGAATAGCCAAAACCAAAGGGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGACTGTTTGGTTTGGGCATGGGCATTGTTTTGGGTTTTCTAGGGAATGCCGCTGTCTCAACTCAAGCTCAACTTGAGATGGGTTATTATTCTAAGAGCTGCCCAGAAGCTGAAAAAATT
GTGAGAGAGTTGTCGAAGATNCACATCCGCAATGCTCATTCTTTAGCAGCCGCTCTGCTGAGGACGCACGTTCATGATTTCTTTGTTGG
GGGTTGTGATGCTTCTGTGCTCTTCAACTCT
AGTTGAAGCAACCCAGCAGAGAGAGATTCTCCTCCAAACTTCACTATGAGAGGCTTTGACTTCATCGATCGAGTGAAGAGCCTTGTCGAAGCTGAATTCCCGGGGATTGTCTCTTGCGCA
GACATCATAGCTTTGGCCGCAAGAGATGCAACAGTGGCC
GGAGGTCCATTTTGGAGAGTTCCTACGGTAAGAAGATATGGAGTAATTTCAAGGGCATCGGAAGCATTGAGCAACATCCCT
TCTCCATCCAGCAAACTCAACGGTCCCCAAATATTTTTCGCCAATAAAGGAGTCGATCTTAAAGACTTAGTTTTATCTTCC
GGAGCTCACACATTTGGTGCATCTCCCTGCTCGTCTTTC
CGGAACCACCTATACAACTTCACTGGCGGTGAGGATCAAGACCCCTCCTTGGAAAGCGGGTACGCGGCGAATCTCAAGGCCAAGAAGTGCAGGAGCCTGAGTAACGATACCATCTTTCGA
TCGGATTCTGCTATCACTACCGGTCCTGCTTCCAAGCTCTTCATCACACAAGTCCTTCAAGGGTCACTTGACAACTTCTACGCTCAATTTGCCTTGGCAATGGAGAAGATGGGCCGGATC
GACGTGAAGACTGGGCTGGCAGGCGAGATAAGGAAGCATCGTGCGCTGTTGAATAGCCAAAACCAAAGGGAA

Retrieve as FASTA