Entry information : EgrPrx[P]42
Entry ID 10462
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EgrPrx[P]42
Name EgrPrx[P]42
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]42
start..stop
S start..stop
EguPrx[P]42 558 0 1..319 1..319
EcamPrx[P]42 549 0 1..315 1..320
EguPrx[P]46 542 0 4..315 1..313
EgrPrx[P]46 519 0 4..315 1..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15356689..15356907 219 N° 2 15358662..15358851 190 N° 3 15358974..15359137 164 N° 4 15359243..15359626 384
join(15356689..15356907,15358662..15358851,15358974..15359137,15359243..15359626 )


exon

Literature and cross-references EgrPrx[P]42
DNA ref. Phytozome 11:   scaffold_1 (15356689..15359626)
Protein sequence: EgrPrx[P]42
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (289)
PWM (Da):   %s   33806.91 (31157.5)  
PI (pH):   %s   8.62 (8.62) Peptide Signal:   %s   cut: 26 range:26-314
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAWESSSVNPAFLLLLRFLSGTASAELSSTLYSTSCPSALDTIKCGMSSVVSSKARMGVPLLRLCFHDCFINAHGLILLEYTANFAKKKNVSPNANSIQVFEVIDMIKSQLESTCPRVVSCANTLVVTA*DSIVALSGPNWTVSLGRRDSTGASQSAAISNIPAPSLNLSDLISSFSSKGFTVKEMAALLSHTIGQA*CLTFRAQLYDNQHRICNITESKLSELCRRRQPLSS*RHEPDVHRQCLLKNLQIQKDLLNSD**MFSGGAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSSSQIRKNYGKVNSCSF

Retrieve as FASTA  
Remarks Pseudogene from genomic (stops in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGGGAGAGCTCTTCTGTCAATCCCGCCTTCTTATTGTTACTCCGTTTCCTTAGCGGAACAGCCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCAGCGCCCTC
GACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCTCCGCCTTTGCTTCCACGATTGCTTCATCAATGCA
AGCCTCTCTGCTCTGAGTCTC
CCCCCTCTTTCCGATTGATTTTTACCTTTGTTTTTCTCTTTAATTCAAGCTGCGTGCAAGCGTGCATGCATGATGCATCTTCGTGCTTGTGCGTGTGAAGCATTCCAACCAACCACGTTG
TCAAAAGAATTATTAGATTCGCGTCTACACAAGTTAGGTAGGAGGTTCACATATTGAATTAGTTGAGTCTGATACTTTTTGGTGTTTTGCGGTGCCATGCATTTTTGTGAGTTTATTATA
TTATTAATCGATTTTGTTTGTTATAACAAAATATTTTTTTTGGTAAATGAAAAAAACTTTTTCATGAGTATCGTTAGTATACGCTGCCGGTGTAAAAATGGTTTTTTACAAACGGGCTTA
TCCACCCTTAATTTGGCTGTTAGTGAGGGATTTGGAATCTTCAAATCATGGATAAGAATGGTTACGTAAAGTTTTCTTTACACCGATAGTGCACGCTTTAATTTTCTTATATTACAAAAA
ACAATGCGGTTGATCAGATGTATATGTGATTAACTACCTGGTTTAAATCCAATGAACTCGATGAATTGGATCACATAAAGTCCTGAACGTTGGAGCTTAAAAATGATATTTTATGGTAAA
TTATCATTTTTAATGAAATATGTTAATCAAATGGTACTCTAAAATCTTATTAGATCTTTGAACAAGCGAATCGCGCCTTGTGCATGGCCTCACTAGTTTGCTTCCACACAAATTTAGAGT
GTCAATCTAAATAAACCAATCAATTTAGTGTACCTACTTTGTTATCCTCTTCATCTTCTTTGTGCATAATTTTAGAGTAGTCTATATCCTAATGAGGGGTAAGTATATTAAAAGTACCAA
AAGCTGTATACAGCGCTCACTTTAGTGCCAAAAATTTTCGCCGGCTCACTTAAATGCCAAATCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAACGATCATCTAAGTTCCAACGAAGAGAA
ATTCCAACCAAATTGATTACGTCTCATTTATAATTAAAATTTTAATATGACTTGACAAATTTTTTAAAAACTCCAATCCATGTGGCATTTTCACGTGGCATGCTTGGCAATGAAGTGATG
GCTTTTTAATAACAACTAGTTCTAAAGTGATCACTTTAAACAAAATTTAGCATTTAAATTATCACTATTTACAAATTTTGAACGATGTCGTTTATGTGTTATATGCTGACTAGGCACGTT
GGCGAGCCACGTAGGACTGAGAAATTAATAAAACGCAATCACATCGGATTTCTGGTAACCCAAACCAGAATTGACACTTAAAAGTTTTTTTTTTTTTTAAAAGTAGCACTTAAGTGATCC
AATAAAACTTTTAACACTAAAGTGAGTATTGTACACAACTTTTGACACTTTTAGTATATTTATCCCTCCTAATGGAGCTTTCTCCATCAAACATGTCTCTATTTCAATCTCAACATTCAA
AGCCCGATCGGGCTTTTATGGATGCATTGTTCCTTCAGAGAAAACACGAAGCAAAGTCGTAAGGCACGAGAAAAATTGGAGAACTTCCTATTTAATGTCACCCCGTCAAAACTGGTGTCT
CTAGGCGTTCATGATGGGGACAAAAAGGTGGAAAAGGATAGGGGAAAAATTCAATGTCCGTACTCGATTTTCAGGAAAAATTATAGCCTTTAACCCGTTTGCAACCATTGAATTTAATGG
ACTCCAATCCCATCGATTTTCTATTTAGAAGGACTAATGTGTGGCATAGATGACACGGGTTGATTTTATTGGAGTACACCGCAAACTTCGCTAAGAAGAAGAATGTTAGCCCGAATGCCA
ATTCTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTAGAGAGCACGTGCCCCAGGGTCGTATCCTGTGCCAACACATTGGTTGTTACTGCATGAGATTCCATTGTTGCCT
TAA
GTGCACATTTTCTTCTCAATTCTAGTGATCAATTGTGAGGAGAAAAAAATCACATGTTGTGTTCTCCATGCTATATTAATACTAACACATATGTATTTATTTTTTACTTAATTTTTA
GTTAGGTGGCCCGAATTGGACAGTCTCACTTGGAAGAAGAGACTCAACCGGCGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTC
CTTCTCTAGCAAAGGCTTCACCGTCAAAGAAATGGCGGCACTCTTAGGT
CATTGTCTTTATTTTTTTCACCTATTAAAAAAGAATTTATGATAATGCTCGATCAATATACTGAGAACAAT
TTACAAAACATTGTTTGATTGTTTGTTAACAAAATCGCATACGATAGGTCAAGCCTGATGCTTGACTTTCCGGGCCCAACTTTATGATAATCAACACCGCATATGCAACATCACTGAAAG
CAAACTGTCCGAGCTCTGTAGGCGACGACAACCCCTCTCCTCTTGACGCCACGAGCCCGACGTCCATCGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGGA
CTAGTAAATGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGAAACCTCAACCCGCT
CACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAACTCATGTTCGTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGGGAGAGCTCTTCTGTCAATCCCGCCTTCTTATTGTTACTCCGTTTCCTTAGCGGAACAGCCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCAGCGCCCTC
GACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCTCCGCCTTTGCTTCCACGATTGCTTCATCAATGCA
CACGGGTTGATTTTATTGGAG
TACACCGCAAACTTCGCTAAGAAGAAGAATGTTAGCCCGAATGCCAATTCTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTAGAGAGCACGTGCCCCAGGGTCGTATCC
TGTGCCAACACATTGGTTGTTACTGCATGAGATTCCATTGTTGCCTTAA
GTGGCCCGAATTGGACAGTCTCACTTGGAAGAAGAGACTCAACCGGCGCAAGCCAAAGTGCTGCTATTAGC
AACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTCCTTCTCTAGCAAAGGCTTCACCGTCAAAGAAATGGCGGCACTCTTAGGT
TCGCATACGATAGGTCAAGCCTGATGC
TTGACTTTCCGGGCCCAACTTTATGATAATCAACACCGCATATGCAACATCACTGAAAGCAAACTGTCCGAGCTCTGTAGGCGACGACAACCCCTCTCCTCTTGACGCCACGAGCCCGAC
GTCCATCGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGGACTAGTAAATGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCG
GCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGAAACCTCAACCCGCTCACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAACTCATGTTCGTTC

Retrieve as FASTA