Entry information : EgrPrx[P]46
Entry ID 10463
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EgrPrx[P]46
Name EgrPrx[P]46
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]46
start..stop
S start..stop
EcamPrx[P]42 546 0 1..313 4..320
EgrPrx[P]42 536 0 1..313 4..315
EguPrx[P]46 529 0 1..313 1..313
EguPrx[P]42 521 0 1..313 4..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22318233..22318445 213 N° 2 22314881..22315066 186 N° 3 22314593..22314759 167 N° 4 22314118..22314490 373
complement(join(22314118..22314490,22314593..22314759,22314881..22315066,2231823 3..22318445))


exon

Literature and cross-references EgrPrx[P]46
DNA ref. Phytozome 11:   scaffold_1 (22318445..22314118)
Protein sequence: EgrPrx[P]46
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309 (287)
PWM (Da):   %s   33657.98 (31306.7)  
PI (pH):   %s   8.67 (8.67) Peptide Signal:   %s   cut: 23 range:23-309
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ESSSVNPAFLLLFRFLLGTTSAELSSTLYSKFWSSSALDNIKCGMSSVVSSKAHMGVPLLRLCFHDCFINAHGLILLAYTANFTENKNVRPNVNSIRIFEVIDMIKSQLESTCPNVMSSADILVVAA*DSIVALGGPSWTISLGRRDSTSASQSAAISNIPAPNLNLSDLISSFSNKGFTTKEMAALLGSHTIGQA*CLTFQAQLYNNQHRIYNITESKLSELRRRQQPISS*RHEPDVLRHCLFKNLQIQKDLLNSD*QLFSGGAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSCSQIRKNYGKV

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' is missing, stops in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGCTCTTCTGTCAACCCCGCCTTCTTATTGTTATTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCAAATTCTGGAGCTCCAGCGCCCTCGACAAC
ATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCACATGGGTGTGCCGCTGCTCCGCCTTTGCTTCCACGATTGCTTCATCAATGCA
AGTCTCTCTGCTCTGAGTCTCTCCTCT
CTTTCCGATTGATTTTTACCTTTGTTTTTATCTTTCATTCAAGCTGCGTGCAAGCGTGCATGCATGATGCATCTTCGTGCTTGTGCGTGTGAAGCATTCCAACCAACCACATAGTCAAAA
GAATTATTAGATTCGCGTCTACACAAGTTAGGTAGGAGGTTCACATATTGAATTAGTCGAGTCTGACACTTTTTGGTGTTTTGTGGTGCCATGCATTTTTGTGAGTTTATTATATTAATT
AATCGATTTTTTTTGTTATAACAAAATAATTTTTTTGGTAAATAAAAAAAACTTTTTCATGAGTATCGTTAGTATACACTGCCGGTGTAAAAATATTTTTTTACAAACGGGCTTATCCAT
CTGAATTTGGCTGTTAGTGAGGGATTTGGAATCCTCAAATCATGGATAAGAATGGTTATGTAAAGTTTTCTTTACACCGATAGTGCACGCTTTAATTTTCTTATATTACAAAAACGATGT
TGTCGATCAGATGTATATGTGATTAACTACCTGCTTTAAATCCAACGAACTCGATGAATTGGATCACATAAAGTCCTGAACGTTGGAGCTTAAAAATGATATTATAGGGTAAATTATCAT
ACCCTAAAATATCATTTTTAATGAAATTTGTTAATCAAATGGTACCCTAAAATCTTATTAGATCTTTGAACAAGCAAATCGCGCCTTGTGCATGACCTCACTAGTTTCCTTCCACACAAA
TTTAGAGTGTCAATCTAAATAAACCAATCAATTTAGTGTACCTACTTAGTTATCCTCTTCATGCTCTTTGTGCATAATTTTGGAGTTGTATGTATCCTAACGAGGGATAAGTACACTAAA
AGTGTGTTTGGTAACGTTTCTATTTCAGGAAATAATTTTTAAACATAAATAGTTTTTTTTTGTTTCTGTTCCAAGGAACAATTTCTGAGTATAAGAACACATTTGATAACTGCAAAAAAT
TTCTACTCCAGGAATAGAAACACGTTTGGTAACTTGTATAATTTTTTTTATTTCTTTTAATTTTTTAATATTTTATTCTTTTTTTCTTTTTTTCTTTTTTTTCTTCTTTCTTCCTTTTGG
CCGGTCGCCAGCCATGGCCGAGGCCGACGACCAACCAAAAGGAAGAAAAAAGAAGTGTTTCTCAAAAGTGTTTCCGGGAACAAGAAACAAGTTTTTTTTTACTTCTTGTTTCTGTTCCAA
ATCTTTCTCAGGAACAAAAAAAAAAAATAGATTTTTTGTTCTTGGAAACAAAAATGTAAACAAACGCGTTTCTGTTCTTTTTTCATTCCTCAGAACAAAAGAACAAAAATTTGTGTTCCG
AGGAACAGAAACAAAATTAAACAAACACACCCTAAAAGTACCAAAAGTTGTATACAACGCTCATTTAGTGTCAAAAATTTTCGCCGGCTCATTTAAGTGCTAAATCAAAGAAAAAACAAT
CATCTAAGTGCCAACAACGAGAAATTCTAGCCAAATTGATTATGTCTCATTTATAATTAAAGTTTTAATGTGACTTGACAAATTTTTTAAAAATTCCAATCCATGTGACATTTTCACGTG
GCATGCTTGGCACTAAAGTAATTACGTTTTAATAACAACTAGTACTAAAGTGATCACTTTAAATGAAATTTAGCATTTAAATAATCACTATTTACAAATTTTGAACGACGTCATTTATGA
CTTATATGCTGACTAGGCACATTGGCAAGCCATGTAGGACTGAAAAATTAATAAAATATAGTCACGTAGGACTGAAAAATTAATAAAATATAGTCACGTAGGACTGAAAAATTAATAAAA
TATAGTCACGTCGGATTTCTAGTAACCCAGACTAGAACTAACACTTACAATGTTTAAAAAAAAAAGAAGTGGTACTTAAGTAATGCGAAAAAAAATTTGACACTAAAGTGAATACTGTAC
ACAATTTTTAATACTTCTAGTATACTTATCCCTCTTAATGGAGCTTTTTCCATCAAACATGTCTCCATTTCGATCTTGACATCCAAAGCCCGATCGGTTTTTTAATAACAATTACTGGAT
GCATTGTTCCTTCAGAGAAAACACAAAGCAAAGTCGAAAGGCACGAGAAAAGTTGGAGAACTTCCTATTTAGTGTCACCCCGTCAAAACTGGTGTCTCTAGGCGTTCATAATGGGGAACA
AAAAGGTGGAAAAGGATAGGGGAAAAATTCGAGGTTGGGACACCTAGAGTGCCATAACTTGGCATGGAGGGACACTTAAGTGCCATAACTTTAAAATGGTACACTTAAGTGCCAATATCG
GAGTAAAATGGGACACTTAAGTGCCACTCCGGCGAAAATCCGGCCAAATGGCTGACGTGGCAATTTTCCGGCGAGTTTGGTCCAAAACGGCGTCGTTTTGCACGCTAACGTGGCGGAGAA
AACGCAAAAACGACGTTGTTTCGTGTCTACATATAAATAATAACATATAAATTAATTAAATTAGATTTAAATATTCAAAAAATTTAAAAATTTAAAAAATTTTAAAAAATTAAGAAAAAT
TTTAAAAATTTTAAAAATTAAGAAAAATTAAAAATTAAAAATTAAAAATTAAAAATTAAAAATTTAAACGACGTTGTTTCGGCCCGGCGACCCCGGCCGACCCTCCCCACTCCGTCGCCG
GCCCTTTAAATTTTTCTTGAGGGGGCTTTTTTTTCTTAATTTTTCTTAATTTTCTTAAATTTTCTTATTTTAAAAAAAATTGAATATTTTAAATTAAATTTAATTAATTTTTATATTATT
ATTTACACGTAGACACGAAATGGTGTCGTTTTTGCATTTTCTCCGCCACGTCAGCGTGCAAAACGACGCCGTTTTGGACCAAGCTCGCCGGAAAGTCGCTACGTAAGCCATTTGGCCAGA
TCTTCGCCGGAGTGACACTTAAATGTCCCATTTAACTTCGAAACTGGCACTCAAGTGTACCATTTTAAAGTTATGGCACTTAAGTGTCCCTCGGTGCCAAGTTATGGCACTTGCGATGTA
CTTCTGCCGGAAAAATTCAATGTCCGTACTCGATTTTCAGGAAAAATTATAGCCTTTAACCCATTTGCAACCATTGAATTTAATGGACTCCAATCTGATCGATTTTCTACTTAGAAGGAC
TAATGTGTGGCGTAGATGCCACGGGTTGATTTTATTGGCGTACACCGCAAACTTCACTGAGAACAAGAATGTTAGACCGAATGTCAATTCTATACGGATATTTGAGGTGATTGATATGAT
CAAGTCCCAACTAGAGAGCACGTGCCCCAATGTCATGTCCAGTGCCGACATATTGGTTGTTGCTGCATGAGATTCCATCGTTGCC
TCAAATGCACATTTTCTTCTCAATTCTAGTGATCG
ATTGTGAGGAAAAAAAATCACATATTATGTTCCCCATGCTATATTAATACTAACACATATGGATTTATTTTTTACTTAATTTTGAGTTAGGTGGCCCGAGTTGGACAATCTCACTTGGAA
GAAGAGACTCAACCAGTGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAATCTGAACCTTAGCGACCTCATCTCTTCCTTCTCTAACAAAGGCTTCACCACCAAAGAAATGG
CGGCACTCTTAGG
TCATTGTCTTCTTTTTCACCTATTAAAAAAGAATTTATAATAATGCTCGATCGATATACAAAGAACAATTTACAAAACATTGTTTGATTGTTTGTTAACAAGATCGC
ACACGATAGGTCAAGCCTGATGCTTGACTTTCCAGGCCCAACTTTACAATAATCAACACCGCATATACAACATCACTGAAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCATCT
CCTCTTGACGCCACGAGCCCGACGTCCTTCGACACTGCCTTTTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGGACTAGCAATTGTTCAGTGGCGGTGCCATAGACTTTCAAG
GGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGGCTCATGCAGTCAAATTAGGAAGAACTATGGAA
AGGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGCTCTTCTGTCAACCCCGCCTTCTTATTGTTATTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCAAATTCTGGAGCTCCAGCGCCCTCGACAAC
ATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCACATGGGTGTGCCGCTGCTCCGCCTTTGCTTCCACGATTGCTTCATCAATGCA
CACGGGTTGATTTTATTGGCGTACACC
GCAAACTTCACTGAGAACAAGAATGTTAGACCGAATGTCAATTCTATACGGATATTTGAGGTGATTGATATGATCAAGTCCCAACTAGAGAGCACGTGCCCCAATGTCATGTCCAGTGCC
GACATATTGGTTGTTGCTGCATGAGATTCCATCGTTGCC
TTAGGTGGCCCGAGTTGGACAATCTCACTTGGAAGAAGAGACTCAACCAGTGCAAGCCAAAGTGCTGCTATTAGCAACATT
CCTGCCCCAAATCTGAACCTTAGCGACCTCATCTCTTCCTTCTCTAACAAAGGCTTCACCACCAAAGAAATGGCGGCACTCTTAGG
ATCGCACACGATAGGTCAAGCCTGATGCTTGACT
TTCCAGGCCCAACTTTACAATAATCAACACCGCATATACAACATCACTGAAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCATCTCCTCTTGACGCCACGAGCCCGACGTCCTT
CGACACTGCCTTTTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGGACTAGCAATTGTTCAGTGGCGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACT
TTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGGCTCATGCAGTCAAATTAGGAAGAACTATGGAAAGGTCAAC

Retrieve as FASTA