Entry information : EgrPrx112
Entry ID 10470
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2016-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-13 (Achraf Jemmat)
Peroxidase information: EgrPrx112
Name EgrPrx112
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx112
start..stop
S start..stop
EglPrx112 640 0 1..319 1..319
EguPrx112 638 0 1..319 1..319
EcamPrx112 635 0 1..319 1..319
EglPrx113 626 0 1..319 14..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 49671284..49671502 219 N° 2 49670969..49671160 192 N° 3 49670651..49670813 163 N° 4 49670116..49670501 386
complement(join(49670116..49670501,49670651..49670813,49670969..49671160,4967128 4..49671502))


exon

Literature and cross-references EgrPrx112
Protein ref. GenBank:   NW_010092444.1 (49669452..49668066)
Cluster/Prediction ref. Genebank:   104454442
Protein sequence: EgrPrx112
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   34386.86 (31891.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.9 (9.90) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATHNIVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFVGEKTAGPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRRDSITASRSLANTLPSPASNLSALITSFAAKGLSVKNMVALSGSHTIGLARCSSFRGRIYNDLNIDTSFAHKLQKTCPKIGNDSVLQRLDIQTPTFFDNLYYRNLLQKKGLLHSDQELFNGSSVDSLVKKYACDTEKFFRDFVRAMIKMSEIKPPKGSNGQIRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns). No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACAATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACAGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTTGTCAAT
GTGATTCGCGTCTTCTAGAGA
TTCCTTGCGAAACGATCCCACTTTGATTCATTAGCCTTCCAGAGTTTTCCTCTTCTTTTCCTTCCTCCTCAATATTGATGTGTGTATCTACGAATTGGTCAGGGGTGCGATGCGTCGATA
TTGTTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGGTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGA
GTGGTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAAT
TTAGTACATTTTTGCCTCGACGGTTATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCTCGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAG
GGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGG
TGGCTCTTTCTG
GTAATTTCAACTCAATATTAGCAACCTTGCACCGCGCATTACAACCAAGAATATTCAAAAGAAAAGAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAATGT
CGATGTACTTTATCAGCTGACAGTGGTTTTCAAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCAGTTCCTTCCGAGGACGGATCTACAACGACTTGAACATAGATACATCCTT
CGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCGCAATTTACTGCAGAAGAA
GGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACAGAAAAATTTTTCCGAGACTTTGTTAGGGCAATGATCAAAAT
GAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACAATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACAGGCGCGTCCTTGCTTCGGCTGCACTTCCATGACTGCTTTGTCAAT
GGGTGCGATGCGTCGATATTG
TTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCAGGTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTG
GTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAGGGATTCCATTACTGCTAGCAGGAGCCTTGCT
AACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGA
TGCAGTTCCTTCCGAGGACGGATCTACAACGACTTGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATC
CAAACGCCGACCTTCTTTGACAACCTTTACTACCGCAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTAT
GCATGCGACACAGAAAAATTTTTCCGAGACTTTGTTAGGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAACTAA

Retrieve as FASTA