Entry information : EgrPrx[P]90
Entry ID 10472
Creation 2012-02-07 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EgrPrx[P]90
Name EgrPrx[P]90
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]90
start..stop
S start..stop
EguPrx[P]90 614 0 1..312 1..312
EglPrx[P]90 521 0 1..312 4..271
EgrPrx[P]89 393 5e-139 60..312 43..291
EcamPrx[P]89 392 2e-138 60..312 34..283
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5064291..5064671 381 N° 2 5064784..5064945 162 N° 3 5065067..5065459 393  
join(5064291..5064671,5064784..5064945,5065067..5065459)


exon

Literature and cross-references EgrPrx[P]90
DNA ref. Phytozome 12:   scaffold_6 (5064291..5065459)
Protein sequence: EgrPrx[P]90
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310
PWM (Da):   %s   33060.51  
PI (pH):   %s   6.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LIFCHVGLHRL*MSYSILGDSSTSIQAALSVKLWSSRGSKRG*NKSSMACQQKMLMISRFEQGCDASVLLDDTEGFTGEKTAGSNVNSIHGFDVVDNIKTRLEEQCPRIVSCADILAVAAHDSVAAVGPTWTVQLGRRDSTTASLKDANSDVPLGIADLSDLISLFSKKGLSAKEMVALSGAGTHTIGQARCFVFRIRIYNEKNIDPAYAASLRQNCPSAGGDANLVPLEDGDVDGKVFNNDYFKNLVSMKGLLHSDQQLFNNGSTDADVKAYSLDSASFFADLANALVKMGNLSPLTGTDGQVRTNCRKVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (Short 5' end is missing; Stop in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTAATTTTTTGTCATGTCGGTCTTCATAGATTATGAATGTCATATTCAATTCTAGGCGATTCTTCTACTTCCATCCAAGCTGCTTTATCTGTCAAACTTTGGTCTAGCAGAGGGAGCAAA
CGAGGTTGAAACAAAAGCTCAATGGCTTGTCAACAAAAAATGCTAATGATATCGAGGTTTGAACAGGGTTGTGACGCGTCTGTATTGTTGGACGACACCGAAGGATTCACCGGCGAGAAG
ACGGCAGGCTCCAATGTCAATTCAATCCATGGTTTTGACGTGGTTGACAACATCAAGACTCGGCTTGAAGAACAATGCCCCAGAATCGTTTCATGTGCCGACATCCTAGCCGTCGCGGCC
CACGATTCTGTCGCTGCCGTA
AGATGCCTTTGCTACGTGTAGTCTTATATCCCTTTTTCGATCATTAAGACAGAAGGCGATTGTGTTCAGATCGATTATCCTAACCGGGGATCATGCAAA
AAATTTCAGCTGGGGACCCACGTGGACCGTACAGTTAGGCAGGAGAGATTCAACCACGGCAAGTTTGAAAGATGCAAACAGCGATGTGCCTTTGGGAATCGCGGACCTTAGCGATCTCAT
ATCTCTCTTCTCTAAGAAGGGCTTATCTGCCAAAGAAATGGTCGCCCTCTCAGGT
GTTTCATCTAAGAGAGAAGTGTCATTCTTTTGGTCTTTGCACTTTGGAAAGGTTTTCTTTAATTG
TCGTTGGGAGAAAATCGCCTGACCACGATCCACCGTCGTATATGCGCTTTTGTACCGCAGGTACTCACACGATAGGCCAAGCGAGGTGCTTCGTGTTCCGCATTCGCATCTACAATGAGA
AGAACATCGACCCCGCGTACGCCGCGTCGCTGAGGCAGAACTGTCCCAGCGCAGGCGGGGATGCTAATCTCGTGCCGCTCGAGGATGGCGACGTCGACGGCAAAGTGTTCAACAACGACT
ACTTCAAGAACCTAGTGAGCATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTCAACAACGGATCCACTGACGCGGATGTGAAGGCCTACAGCCTCGACTCGGCATCCTTCTTCGCCG
ATCTGGCCAATGCCCTGGTGAAGATGGGGAACCTCAGCCCCCTCACGGGAACGGACGGGCAAGTTAGGACCAATTGCAGGAAGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTAATTTTTTGTCATGTCGGTCTTCATAGATTATGAATGTCATATTCAATTCTAGGCGATTCTTCTACTTCCATCCAAGCTGCTTTATCTGTCAAACTTTGGTCTAGCAGAGGGAGCAAA
CGAGGTTGAAACAAAAGCTCAATGGCTTGTCAACAAAAAATGCTAATGATATCGAGGTTTGAACAGGGTTGTGACGCGTCTGTATTGTTGGACGACACCGAAGGATTCACCGGCGAGAAG
ACGGCAGGCTCCAATGTCAATTCAATCCATGGTTTTGACGTGGTTGACAACATCAAGACTCGGCTTGAAGAACAATGCCCCAGAATCGTTTCATGTGCCGACATCCTAGCCGTCGCGGCC
CACGATTCTGTCGCTGCCGTA
GGACCCACGTGGACCGTACAGTTAGGCAGGAGAGATTCAACCACGGCAAGTTTGAAAGATGCAAACAGCGATGTGCCTTTGGGAATCGCGGACCTTAGC
GATCTCATATCTCTCTTCTCTAAGAAGGGCTTATCTGCCAAAGAAATGGTCGCCCTCTCAGGT
GCAGGTACTCACACGATAGGCCAAGCGAGGTGCTTCGTGTTCCGCATTCGCATCTAC
AATGAGAAGAACATCGACCCCGCGTACGCCGCGTCGCTGAGGCAGAACTGTCCCAGCGCAGGCGGGGATGCTAATCTCGTGCCGCTCGAGGATGGCGACGTCGACGGCAAAGTGTTCAAC
AACGACTACTTCAAGAACCTAGTGAGCATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTCAACAACGGATCCACTGACGCGGATGTGAAGGCCTACAGCCTCGACTCGGCATCCTTC
TTCGCCGATCTGGCCAATGCCCTGGTGAAGATGGGGAACCTCAGCCCCCTCACGGGAACGGACGGGCAAGTTAGGACCAATTGCAGGAAGGTTAAT

Retrieve as FASTA