Entry information : EgrPrx[P]147
Entry ID 10474
Creation 2012-02-08 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EgrPrx[P]147
Name EgrPrx[P]147
Class Class III peroxidase     [Orthogroup: Prx161]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]147
start..stop
S start..stop
EguPrx[P]147 605 0 1..312 1..312
EglPrx[P]147 596 0 11..312 22..323
EglPrx148 572 0 1..312 11..322
EguPrx148 570 0 1..312 11..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13116456..13116644 189 N° 2 13116189..13116380 192 N° 3 13115937..13116095 159 N° 4 13115397..13115792 396
complement(join(13115397..13115792,13115937..13116095,13116189..13116380,1311645 6..13116644))


exon

Literature and cross-references EgrPrx[P]147
DNA ref. Phytozome 12:   scaffold_10 (13116644..13115397)
Protein sequence: EgrPrx[P]147
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (295)
PWM (Da):   %s   33518.72 (31849.9)  
PI (pH):   %s   7.6 (7.98) Peptide Signal:   %s   cut: 17 range:17-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FTLSCTLLLLMGCSDAQLSPDFYSKTCPNVFTAVKSRVESTVKKEPRMGASLLCLFFHDCFVNGCDGWVLLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSVVEKVCPGIVSCADLLAITARDSIVLLGGPSWNVKLGRRDARTASQAATNSSLPSPT*NLTDLISSFENSGLSTTNLVALTGSHSIGQAKCANFRARIYNETDLDRSFGEIRRKNCPSSASPRDNNLAPLDLQSPVAFDNTYYTNLLQFKGLLHSNQQLFNGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRKNYRKIN

Retrieve as FASTA  
Remarks Pseudogene from genomic (stop in frame and short 5' end is missing). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTTTCCCCCGATTTCTATTCAAAAACATGTCCGAACGTCTTCACCGCGGTCAAATCCCGGGTGGAATCC
ACTGTCAAGAAGGAACCTAGAATGGGAGCCTCCCTCCTCTGCCTGTTTTTCCATGATTGCTTTGTGAAT
GTAAGCTACCATAAATTGACTTATCTTTCTTTCATTGTATCCTAGAAATTC
ATTTTGTCTTTCGTCTATTGCCAGGGCTGCGATGGATGGGTTCTTCTCGACGACACGCCAACTTTCACTGGTGAAAAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTCGAGGTC
ATAGACGATGTCAAGTCTGTTGTGGAGAAAGTGTGCCCTGGTATTGTTTCTTGCGCTGACTTGTTGGCCATCACCGCTCGTGACTCCATCGTCTTG
GTAAGCCCTCCCAATCCCTCCAAA
AAAAATCACTACCCCATACAAGTACTACTCACAAATTTGCTATAACTAAGATTGTGTTGAAATTTGCAGCTTGGAGGGCCAAGCTGGAACGTGAAACTCGGAAGGAGAGATGCAAGAACC
GCGAGCCAAGCAGCTACTAACAGTAGCCTTCCCTCTCCAACCTGAAACCTTACCGACCTCATATCTAGCTTTGAAAATTCTGGCCTCTCCACGACAAACTTGGTGGCT
TTATCTGGTACG
TACACTCATAAACACAATCCCGAACGGTTGCTGGAATAATAATGCAAAAAACATTTTTTTTTAATTTTTTTTATTGTAAATGGAGAAAAAAAGAAAAAGAAAAAAAAGAGATACTAACTT
ATCATATTTGTTTTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGCAAATTTCAGAGCTCGGATCTACAATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAAC
TGCCCAAGCTCAGCTAGCCCGAGGGACAACAATCTAGCCCCACTCGACTTGCAGTCTCCCGTTGCATTTGACAACACTTACTACACCAACCTTCTCCAGTTCAAAGGACTGCTTCACTCC
AACCAGCAGCTCTTCAATGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGTAGCCCGAGCACCTTCAGCTCCGACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCC
CTCACCGGATCAGATGGTGAAGTCAGGAAGAACTATAGGAAGATCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTTTCCCCCGATTTCTATTCAAAAACATGTCCGAACGTCTTCACCGCGGTCAAATCCCGGGTGGAATCC
ACTGTCAAGAAGGAACCTAGAATGGGAGCCTCCCTCCTCTGCCTGTTTTTCCATGATTGCTTTGTGAAT
GGCTGCGATGGATGGGTTCTTCTCGACGACACGCCAACTTTCACTGGTGAA
AAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTCGAGGTCATAGACGATGTCAAGTCTGTTGTGGAGAAAGTGTGCCCTGGTATTGTTTCTTGCGCTGACTTGTTGGCCATCACC
GCTCGTGACTCCATCGTCTTG
CTTGGAGGGCCAAGCTGGAACGTGAAACTCGGAAGGAGAGATGCAAGAACCGCGAGCCAAGCAGCTACTAACAGTAGCCTTCCCTCTCCAACCTGAAAC
CTTACCGACCTCATATCTAGCTTTGAAAATTCTGGCCTCTCCACGACAAACTTGGTGGCT
TTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGCAAATTTCAGAGCTCGGATCTAC
AATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTAGCCCGAGGGACAACAATCTAGCCCCACTCGACTTGCAGTCTCCCGTTGCATTTGAC
AACACTTACTACACCAACCTTCTCCAGTTCAAAGGACTGCTTCACTCCAACCAGCAGCTCTTCAATGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGTAGCCCGAGCACCTTC
AGCTCCGACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGTGAAGTCAGGAAGAACTATAGGAAGATCAAT

Retrieve as FASTA