Entry information : EgrPrx148
Entry ID 10475
Creation 2012-02-08 (Qiang Li)
Last sequence changes 2013-04-03 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-24 (Christophe Dunand)
Peroxidase information: EgrPrx148
Name EgrPrx148
Class Class III peroxidase    [Orthogroup: Prx214]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx148
start..stop
S start..stop
EglPrx148 644 0 1..322 1..322
EguPrx148 622 0 2..322 2..322
EgrPrx[P]147 578 0 11..322 1..312
EguPrx[P]147 575 0 11..322 1..312
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13149685..13149903 219 N° 2 13149403..13149594 192 N° 3 13149146..13149311 166 N° 4 13148612..13149003 392
complement(join(13148612..13149003,13149146..13149311,13149403..13149594,1314968 5..13149903))


exon

Literature and cross-references EgrPrx148
DNA ref. Phytozome 12:   scaffold_10 (13149903..13148612)
Protein sequence: EgrPrx148
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (296)
PWM (Da):   %s   34042.75 (31253.5)  
PI (pH):   %s   4.97 (5.14) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPSSCFVALFTLSCTLLLLMGCSDAQLSPDFYSKSCPDVFTGVKSQVESAVSKEPGIGASLLRLFFHDCFVNGCDGSVLLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSAVEKVCPGVVSCADLLAITARDSVVLLGGPSWSVKLGRRDARSASQAAANSSLPSPASNLTDLISSFESAGLSTTDLVALSGSHSIGQAKCENFRARIYNETDLDRSFGEIRRKNCPSSAGPGDNNLAPLDVQSSVAFDNTYYTNLLQFKGLLHSDQQLFSGGSTDSLVRTYASSPSTFSSDFAAAMIKMGDILPLTGSDGEVRKNCRKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic '3 introns). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCATCATCATGTTTTGTGGCCCTTTTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTCTCCCCTGATTTTTATTCAAAATCGTGTCCCGACGTC
TTCACCGGGGTCAAATCCCAGGTGGAATCCGCTGTTAGCAAGGAACCTGGAATAGGAGCCTCCCTCCTCCGCCTGTTCTTCCATGATTGCTTTGTGAAT
GTAAGCTACCTTAAATTGACT
TTATCTTTCTTTCATTGTCTTCACACATATCCTAGAAATTAATTTCTTGTCTTTCGTCTATTGCCACAGGGCTGCGATGGATCGGTTCTTCTCGACGACACACCAACGTTCACTGGTGAA
AAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTTGAGGTCATAGACGATGTCAAGTCTGCTGTGGAGAAAGTGTGCCCCGGTGTTGTTTCTTGCGCTGACTTGTTGGCCATCACC
GCTCGTGACTCCGTCGTCTTG
GTAAGCCCTCCCAATCCCTTTAAAAAAATCACTACCCCATACAAGTACTACTCACGAATTTGCTCTAACTAAGATTGTGTAAAATTTGCAGCTTGGAGG
GCCAAGCTGGAGCGTGAAACTCGGGAGGAGAGATGCAAGAAGCGCGAGCCAAGCAGCTGCTAACAGTAGCCTTCCCTCTCCGGCCTCAAACCTTACCGACCTAATATCTAGCTTTGAAAG
TGCTGGCCTCTCCACGACAGACTTGGTGGCTTTGTCTG
GTACGTACACTCATAAACACAATCCCGGACGGTCGCTGGAGTAATAATGCAAAAAGCATTTTCTTTTATTCTTTTATTGTAA
ATGGAGAAAAAAAGAAAAAGAGAAAAAAGAGATACTAACTTATCATATCTGTTTTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGAAAATTTCAGAGCCCGGATCTACAATGAGA
CCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTGGCCCGGGGGACAACAATCTAGCCCCACTCGATGTGCAGTCTTCCGTTGCATTTGACAACACTT
ACTACACCAACCTTCTCCAATTCAAAGGACTGCTTCACTCCGACCAGCAGCTCTTCAGTGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGCAGCCCGAGCACCTTCAGCTCTG
ACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGCGAAGTCAGGAAGAACTGTAGGAAGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCACCATCATCATGTTTTGTGGCCCTTTTCACTTTGTCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTCTCCCCTGATTTTTATTCAAAATCGTGTCCCGACGTC
TTCACCGGGGTCAAATCCCAGGTGGAATCCGCTGTTAGCAAGGAACCTGGAATAGGAGCCTCCCTCCTCCGCCTGTTCTTCCATGATTGCTTTGTGAAT
GGCTGCGATGGATCGGTTCTT
CTCGACGACACACCAACGTTCACTGGTGAAAAGAACGCAGCTCCAAACCGAAACTCTGCCAGAGGATTTGAGGTCATAGACGATGTCAAGTCTGCTGTGGAGAAAGTGTGCCCCGGTGTT
GTTTCTTGCGCTGACTTGTTGGCCATCACCGCTCGTGACTCCGTCGTCTTG
CTTGGAGGGCCAAGCTGGAGCGTGAAACTCGGGAGGAGAGATGCAAGAAGCGCGAGCCAAGCAGCTGCT
AACAGTAGCCTTCCCTCTCCGGCCTCAAACCTTACCGACCTAATATCTAGCTTTGAAAGTGCTGGCCTCTCCACGACAGACTTGGTGGCTTTGTCTG
GTTCACATTCGATAGGGCAAGCG
AAATGTGAAAATTTCAGAGCCCGGATCTACAATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTGGCCCGGGGGACAACAATCTAGCCCCA
CTCGATGTGCAGTCTTCCGTTGCATTTGACAACACTTACTACACCAACCTTCTCCAATTCAAAGGACTGCTTCACTCCGACCAGCAGCTCTTCAGTGGCGGCTCCACGGACTCACTGGTG
AGGACATATGCCAGCAGCCCGAGCACCTTCAGCTCTGACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGCGAAGTCAGGAAGAACTGTAGGAAG
ATCAATTAA

Retrieve as FASTA