Entry information : EgrPrx[P]168
Entry ID 10478
Creation 2012-02-08 (Qiang Li)
Last sequence changes 2012-02-15 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EgrPrx[P]168
Name EgrPrx[P]168
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]168
start..stop
S start..stop
EguPrx[P]168 476 1e-173 1..250 1..250
EgrPrx167 466 2e-168 1..250 71..320
EguPrx167 457 7e-165 1..250 71..320
EglPrx[P]168 429 3e-155 1..250 1..227
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15903019..15903219 201 N° 2 15903350..15903898 549  
join(15903019..15903219,15903350..15903898)


exon

Literature and cross-references EgrPrx[P]168
DNA ref. Phytozome 12:   scaffold_11 (15903019..15903898)
Protein sequence: EgrPrx[P]168
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   26577.21  
PI (pH):   %s   7.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FLQGCDGSVLLDDTANFTGEKTAFPNLNSLRGFDVVDTIKSEVENLCPGVVSCADILAIVARDSVMDLGG*SWQVQLGRRDSTTASLNTANTDLPAPTLNLSALITSFSNKGFTAEEMVTFSGSHTIGQARCVTVRARLYNENNIDPSFPTTLKANCPSSRGDNNLSPLDVTSPMSFDNAYFTNLVSQKGLLHSNQQLFSGGSTNAQVTAYSKKLGSFQKEFAKAMVKMGGLSPLTRSTGQIRTNCRRVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (exon 1 is missing, Stop in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTTACAGGGTTGTGATGGGTCAGTTCTACTAGATGACACCGCAAACTTCACTGGGGAGAAGACGGCGTTTCCCAACTTGAACTCCTTAAGGGGATTCGATGTGGTTGACACCATCAAG
TCGGAAGTGGAAAACCTGTGCCCCGGCGTTGTCTCGTGTGCTGACATCTTAGCCATTGTTGCGAGAGACTCCGTCATGGAC
GTAAGCACCCAACTCTCGAGATTTCTTAGAACGTAATTT
TATTATTAATTTCTCAGAATATTCTTTTGAATCAATATGAAGGAAATTTGAGTTTCCTAATCTTACGTGGATTCATTAATTTGATTTTCAGTTGGGGGGATAGAGTTGGCAAGTTCAACT
AGGAAGAAGAGATTCAACCACGGCGAGCTTAAACACTGCTAATACTGACCTCCCAGCTCCAACTCTTAATCTTAGTGCCCTAATCACTTCTTTCTCTAACAAAGGCTTCACTGCCGAAGA
AATGGTAACCTTCTCAGGATCCCACACCATAGGCCAAGCCAGGTGTGTGACAGTCCGGGCCCGCCTTTACAACGAGAACAACATAGACCCGTCGTTCCCCACAACTTTAAAAGCCAATTG
CCCTAGCTCAAGAGGTGACAACAACCTCTCCCCTCTTGACGTCACCAGCCCAATGTCCTTCGACAATGCCTACTTCACCAACTTGGTGAGCCAAAAGGGTTTGCTTCATTCGAACCAGCA
ATTGTTTAGTGGAGGTTCAACGAATGCTCAAGTGACTGCCTACAGCAAGAAATTAGGCTCGTTCCAGAAAGAGTTTGCCAAGGCCATGGTCAAGATGGGTGGCCTTAGCCCTCTCACCAG
GTCCACTGGTCAAATCAGGACAAATTGTAGAAGAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTTACAGGGTTGTGATGGGTCAGTTCTACTAGATGACACCGCAAACTTCACTGGGGAGAAGACGGCGTTTCCCAACTTGAACTCCTTAAGGGGATTCGATGTGGTTGACACCATCAAG
TCGGAAGTGGAAAACCTGTGCCCCGGCGTTGTCTCGTGTGCTGACATCTTAGCCATTGTTGCGAGAGACTCCGTCATGGAC
TTGGGGGGATAGAGTTGGCAAGTTCAACTAGGAAGAAGA
GATTCAACCACGGCGAGCTTAAACACTGCTAATACTGACCTCCCAGCTCCAACTCTTAATCTTAGTGCCCTAATCACTTCTTTCTCTAACAAAGGCTTCACTGCCGAAGAAATGGTAACC
TTCTCAGGATCCCACACCATAGGCCAAGCCAGGTGTGTGACAGTCCGGGCCCGCCTTTACAACGAGAACAACATAGACCCGTCGTTCCCCACAACTTTAAAAGCCAATTGCCCTAGCTCA
AGAGGTGACAACAACCTCTCCCCTCTTGACGTCACCAGCCCAATGTCCTTCGACAATGCCTACTTCACCAACTTGGTGAGCCAAAAGGGTTTGCTTCATTCGAACCAGCAATTGTTTAGT
GGAGGTTCAACGAATGCTCAAGTGACTGCCTACAGCAAGAAATTAGGCTCGTTCCAGAAAGAGTTTGCCAAGGCCATGGTCAAGATGGGTGGCCTTAGCCCTCTCACCAGGTCCACTGGT
CAAATCAGGACAAATTGTAGAAGAGTCAAT

Retrieve as FASTA