Entry information : OsPrx38 (poxN)
Entry ID 1048
Creation 2006-08-23 (Filippo Passardi)
Last sequence changes 2006-08-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx38 (poxN)
Name (synonym) OsPrx38 (poxN)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx38
start..stop
S start..stop
SbPrx19 500 4e-180 33..335 30..332
BdiPrx45 495 3e-178 1..335 1..334
SiPrx153 493 2e-177 31..335 30..332
ZmPrx13 491 2e-176 31..335 30..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7097529..7097768 240 N° 2 7097114..7097296 183 N° 3 7096817..7096982 166 N° 4 7096088..7096506 419
complement(join(7096088..7096506,7096817..7096982,7097114..7097296,7097529..7097 768))


exon

Literature and cross-references OsPrx38 (poxN)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q5
DNA ref. GenBank:   NC_008396.1 (7097768..7096091)
Protein sequence: OsPrx38 (poxN)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (302)
PWM (Da):   %s   35058.34 (31732.7) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.11 (6.10) Peptide Signal:   %s   cut: 34 range:34-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEYATRGDRTASCLSFLCNIVVLLGLAAAAASGQLTDDYYDYCCPQVYRIVRSRVAAAMKAEMRMGASLLRLHFHDCFVNGCDASILLDGTNSEKFAAPNNNSVRGYEVIDAIKADLESACPGVVSCADIVALAAKYGVLLSGGPDYDVLLGRRDGLVANQTGANSNLPSPFDSISVITARFKDVGLNATDVVVLSGAHTIGRSRCLLFSNRLANFSATNSVDPTLDSSLASSLQQVCRGGADQLAALDVNSADAFDNHYYQNLLANKGLLASDQGLVSSSGDPAVAATKALVQAYSANGQRFSCDFGNSMVKMGNISPLTGSAGQIRKNCRAVN

Retrieve as FASTA  
Remarks chromosome 3. 8 ESTs. Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACGCTACTCGTGGAGATCGCACGGCTAGCTGCCTGAGTTTCCTCTGCAATATCGTCGTTCTGCTGGGCCTCGCCGCCGCGGCGGCGAGCGGGCAGCTGACGGACGACTACTAC
GACTATTGCTGCCCCCAGGTTTACCGCATCGTCCGGTCCCGCGTGGCCGCCGCGATGAAGGCCGAGATGCGCATGGGCGCCTCCCTGCTCAGGCTTCACTTCCACGACTGCTTCGTCAAT
GTAATCATCCAACTATTTTATTTTTCCCCTTTTTCTGCTGCTCATTGCAGTGCGCTAGATACACTACGTGCATGCAAGTCGCATTCAAAACGTACACATACCGAAACAAGAAAATGAAAT
TAACGATCTCAATTAACCTGTATAGAGGACTCTGAACTTTCATGTGATATATGTTACTGAACTTCAGAGACTGAACTCTGAACTTCTTACCGACACACTGTGAATTCTGCAGGGCTGTGA
CGCGTCCATCCTCCTTGACGGCACAAACAGCGAGAAGTTCGCGGCGCCGAACAACAACTCGGTGAGAGGGTACGAAGTCATCGATGCGATAAAGGCCGACCTCGAGAGCGCCTGCCCGGG
AGTCGTCTCCTGCGCCGACATAGTAGCCCTTGCAGCTAAATACGGAGTACTACTT
GTACGTTCCTATGTCTCGAATGGAGGGATGAAAATTCATCTTTGATAGTAAAGCACTATAGTATT
ACCAATCGAGCAAAAGAACAATTGATTTTTCAGTCATGCTGAATATATCTGTGTTGGTCTTTGCAGAGTGGAGGACCTGATTATGATGTCCTCCTGGGAAGAAGAGATGGTCTGGTGGCA
AATCAGACGGGGGCGAACAGTAACTTGCCTAGCCCTTTCGATTCGATCAGCGTTATCACTGCGAGGTTCAAGGATGTCGGTCTCAACGCAACCGATGTTGTGGTCTTATCAG
GTACCTCT
ATCTATCTCCTATATCTTCATGCATCGAGCAAAAATTACCTCGTCAATTCTTCAATCAAACATTGATTGGGATTTGACAAATGAATTGATAAAGACACAAATTATGATATCAATAACGAT
GTCGCATCTACTCTACTCGGTGTGGCATGCATAGCAGTTTACGTGGATTATGCATGATTTAGCATTTGTCAGATCAAAAACTAGTTTCTGCACCAATTTGTTACTCCCTCCGTTTCAAAA
TATAGTTATGTTTGGCTACGAATCAATCCAAGACTGATCTGAACTCTTCTGAACCTGAACAGGGGCGCACACGATCGGGCGATCTCGCTGCCTGCTGTTCAGCAACCGGCTGGCGAACTT
CTCGGCGACCAACTCCGTCGACCCGACGCTGGACTCGTCGCTGGCGTCCAGCCTGCAGCAGGTGTGCCGCGGCGGCGCTGACCAGCTGGCGGCGCTGGACGTCAACTCCGCCGACGCGTT
CGACAACCACTACTACCAGAACCTGCTGGCCAACAAGGGCCTCCTCGCCTCCGACCAGGGCCTCGTCTCCAGCTCCGGCGACCCCGCCGTCGCCGCCACCAAGGCGCTGGTGCAGGCCTA
CAGCGCCAACGGCCAGCGCTTCTCCTGCGACTTCGGCAACTCCATGGTCAAGATGGGCAACATCAGCCCTCTCACCGGCTCTGCCGGCCAGATTCGCAAGAACTGCAGGGCCGTCAACTG
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGTACGCTACTCGTGGAGATCGCACGGCTAGCTGCCTGAGTTTCCTCTGCAATATCGTCGTTCTGCTGGGCCTCGCCGCCGCGGCGGCGAGCGGGCAGCTGACGGACGACTACTAC
GACTATTGCTGCCCCCAGGTTTACCGCATCGTCCGGTCCCGCGTGGCCGCCGCGATGAAGGCCGAGATGCGCATGGGCGCCTCCCTGCTCAGGCTTCACTTCCACGACTGCTTCGTCAAT
GGCTGTGACGCGTCCATCCTCCTTGACGGCACAAACAGCGAGAAGTTCGCGGCGCCGAACAACAACTCGGTGAGAGGGTACGAAGTCATCGATGCGATAAAGGCCGACCTCGAGAGCGCC
TGCCCGGGAGTCGTCTCCTGCGCCGACATAGTAGCCCTTGCAGCTAAATACGGAGTACTACTT
AGTGGAGGACCTGATTATGATGTCCTCCTGGGAAGAAGAGATGGTCTGGTGGCAAAT
CAGACGGGGGCGAACAGTAACTTGCCTAGCCCTTTCGATTCGATCAGCGTTATCACTGCGAGGTTCAAGGATGTCGGTCTCAACGCAACCGATGTTGTGGTCTTATCAG
GGGCGCACACG
ATCGGGCGATCTCGCTGCCTGCTGTTCAGCAACCGGCTGGCGAACTTCTCGGCGACCAACTCCGTCGACCCGACGCTGGACTCGTCGCTGGCGTCCAGCCTGCAGCAGGTGTGCCGCGGC
GGCGCTGACCAGCTGGCGGCGCTGGACGTCAACTCCGCCGACGCGTTCGACAACCACTACTACCAGAACCTGCTGGCCAACAAGGGCCTCCTCGCCTCCGACCAGGGCCTCGTCTCCAGC
TCCGGCGACCCCGCCGTCGCCGCCACCAAGGCGCTGGTGCAGGCCTACAGCGCCAACGGCCAGCGCTTCTCCTGCGACTTCGGCAACTCCATGGTCAAGATGGGCAACATCAGCCCTCTC
ACCGGCTCTGCCGGCCAGATTCGCAAGAACTGCAGGGCCGTCAACTGA

Retrieve as FASTA