Entry information : EgrPrx[P]166
Entry ID 10480
Creation 2012-02-08 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EgrPrx[P]166
Name EgrPrx[P]166
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]166
start..stop
S start..stop
EguPrx[P]166 634 0 1..319 1..319
EglPrx[P]166 579 0 1..319 1..297
EgrPrx167 472 1e-169 1..319 1..320
EguPrx167 466 4e-167 1..319 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15873760..15873879 120 N° 2 15874545..15874739 195 N° 3 15874773..15875414 642  
join(15873760..15873879,15874545..15874739,15874773..15875414)


exon

Literature and cross-references EgrPrx[P]166
DNA ref. Phytozome 12:   scaffold_11 (15873760..15875414)
Protein sequence: EgrPrx[P]166
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (293)
PWM (Da):   %s   34224.1 (31582.7)  
PI (pH):   %s   8.62 (8.46) Peptide Signal:   %s   cut: 26 range:26-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNTALKICFVFFVCSIASRPALAQLSNQNYYATRCPKAGCDASILLDDTANFTGEKTAFPNVNSARGFNVIDTIKSKVEKLCPGVVSCADILAVVARDSVVEVFYY*SLMEYTFEAIQRNSFLNLYGFVEFDLQLGGRSWQVQLGRRDSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVTFRNRLYNENDISSSFATSLKAQCPSSGGDNKLSPLDITSPTSFDSAYFSNLVSQKGLLHSDQQLFSGGSTNAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRTNCKRVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (PS is missing, stop in frame). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAGCCCTCAAAATCTGCTTCGTTTTCTTCGTTTGCTCGATCGCATCAAGACCTGCCTTGGCGCAATTGTCTAACCAAAATTACTATGCTACAAGGTGCCCAAAAGCA
CTCGATACCATCAAATCCGCCGTGAAATCAGCAGTCGCCAAGGAGGCTCGCATGGGAGCATCTTTACTCCGTCTTCACTTCCACGATTGCTTCGTCAATGCAAGTCTCATTTGCTTTCTT
CCTCCGCTCTATGTTTTTGCGCTTCACGTCTTTCTCATACTTTTGTTGATGTGTCGCATCCATATCCTTTTCTTTATTCTTTTTTTCATTTGCGTTGGTTATATAATTCCACACGTGTCA
CATACATTAGTGAGTACAGTAAGTTTAGTAGAAAAAATAATTCATAGAAAATTGTGACCAACGTTATGGACATTCGCATCTGTAAGGATTTTTGCAACAAGTGAGATACACAGGCCAATG
ATTCCATTAAATTAAGAAAGAACGGACAGTGAAACGATCATAGCACACCATTAGAAGACCTGCCAACCTTGTGTCTCTAAATTTGTCTTCTTCCTTTGTCCCTAATATTTTCTCCATATT
GTATTCTATTCTAACAGACGAAACGTCTCTCACTTAGCATTCCTTTCCGATTGTTGGTCGGAAAAACAAAAACACTATTGATTTCCTCACAAGTCCAATATTTGGATGATCCTTCCTGAA
TCATTGGATCTTGTAAACCCAATAAGATGAACTATTAATGTTCTTTTTTGTAATATTTTCTACAGGGATGTGATGCATCAATTCTATTGGACGACACTGCGAACTTCACTGGAGAGAAGA
CGGCGTTTCCCAATGTGAACTCTGCAAGGGGATTCAACGTGATTGACACCATCAAGTCAAAAGTGGAAAAATTATGCCCCGGCGTCGTCTCATGCGCCGACATCTTAGCTGTTGTTGCTA
GGGACTCTGTCGTCGAAGTA
AGTGCCCAACCCTGGAAATTTCTTGGAACGTAATTTTATTATTGATCACTAATGGAATATACTTTTGAAGCAATACAAAGAAACAGTTTCCTAAACTTAT
ATGGATTCGTTGAATTTGATCTTCAGTTGGGTGGACGGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCGACCACTGCGAGCTTAAACGCTGCTAATACCAACCTTCCAGCTCCAACTC
TCAATCTCAGTGCCCTTATCACCTCTTTCTCTAACAAGGGCTTCACTGCTAAAGAAATGGTGGCACTCTCAGGATCTCACACAATAGGCCAGGCTAGGTGTGTGACGTTCCGGAACCGAC
TCTACAATGAGAATGACATAAGCTCGTCGTTCGCCACATCTTTAAAGGCCCAGTGCCCCAGCTCGGGAGGTGACAACAAACTCTCTCCTCTCGACATCACGAGCCCGACATCCTTCGACA
GTGCCTACTTCAGCAACTTGGTGAGCCAAAAGGGCTTGCTTCATTCGGACCAACAGTTGTTCAGTGGGGGCTCGACGAACGCTCAAGTGACTACCTACAGCAAGAACTTGGATTTGTTCA
AGAATGATTTTGCCAAGGCCATGGTGAAGATGGGAGGCCTTAGCCCTCTCACCGGGTCTGCTGGTCAGATCAGGACGAATTGTAAAAGAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAGCCCTCAAAATCTGCTTCGTTTTCTTCGTTTGCTCGATCGCATCAAGACCTGCCTTGGCGCAATTGTCTAACCAAAATTACTATGCTACAAGGTGCCCAAAAGCA
GGATGTGATGCATCAATTCTATTGGACGACACTGCGAACTTCACTGGAGAGAAGACGGCGTTTCCCAATGTGAACTCTGCAAGGGGATTCAACGTGATTGACACCATCAAGTCAAAAGTG
GAAAAATTATGCCCCGGCGTCGTCTCATGCGCCGACATCTTAGCTGTTGTTGCTAGGGACTCTGTCGTCGAAGTA
TTTTATTATTGATCACTAATGGAATATACTTTTGAAGCAATACAA
AGAAACAGTTTCCTAAACTTATATGGATTCGTTGAATTTGATCTTCAGTTGGGTGGACGGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCGACCACTGCGAGCTTAAACGCTGCTAAT
ACCAACCTTCCAGCTCCAACTCTCAATCTCAGTGCCCTTATCACCTCTTTCTCTAACAAGGGCTTCACTGCTAAAGAAATGGTGGCACTCTCAGGATCTCACACAATAGGCCAGGCTAGG
TGTGTGACGTTCCGGAACCGACTCTACAATGAGAATGACATAAGCTCGTCGTTCGCCACATCTTTAAAGGCCCAGTGCCCCAGCTCGGGAGGTGACAACAAACTCTCTCCTCTCGACATC
ACGAGCCCGACATCCTTCGACAGTGCCTACTTCAGCAACTTGGTGAGCCAAAAGGGCTTGCTTCATTCGGACCAACAGTTGTTCAGTGGGGGCTCGACGAACGCTCAAGTGACTACCTAC
AGCAAGAACTTGGATTTGTTCAAGAATGATTTTGCCAAGGCCATGGTGAAGATGGGAGGCCTTAGCCCTCTCACCGGGTCTGCTGGTCAGATCAGGACGAATTGTAAAAGAGTCAAT

Retrieve as FASTA