Entry information : EgrPrx137
Entry ID 10485
Creation 2012-02-09 (Qiang Li)
Last sequence changes 2016-01-13 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-13 (Achraf Jemmat)
Peroxidase information: EgrPrx137
Name EgrPrx137
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx137
start..stop
S start..stop
EglPrx137 684 0 1..332 5..336
EguPrx137 678 0 1..332 1..332
EcamPrx137 672 0 1..332 1..331
CclPrx35 569 0 1..331 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34549662..34549889 228 N° 2 34549155..34549346 192 N° 3 34548831..34548996 166 N° 4 34548323..34548735 413
complement(join(34548323..34548735,34548831..34548996,34549155..34549346,3454966 2..34549889))


exon

Literature and cross-references EgrPrx137
DNA ref. Phytozome 11:   scaffold_9 (34549889..34548323)
Protein sequence: EgrPrx137
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (310)
PWM (Da):   %s   36086.56 (33724.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.41 (9.53) Peptide Signal:   %s   cut: 23 range:23-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQSKNFLIIFCVLALAPLGLCAKAGYGGYLYPQFYDHSCPKAQEIVKSVVAKAVAKDPRMGASLLRLHFHDCFVKGCDASLLLDSSGTIISEKRSVPNTNSARGFEVLDEIKSALEKECPQTVSCADLLALAARDSTVLTGGPSWVVPLGRRDSTGASLSGSNNNIPAPNNTFQTILTKFKLKGLDIVDLVALSGSHTIGNARCTTFRQRLYNQTGNGQPDFTLDQSYAAQLRTRCPRSGGDQNLFFLDFVSPIKFDNSYFKNLLAKKGLLSSDEVLVTQSQATLQLVKQYAGNQELFFEQFAKSMVKMGNITPLTGSKGQIRKRCRQVNK

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCAATCCAAGAACTTCCTCATCATTTTCTGTGTTCTTGCTCTGGCTCCACTCGGTCTCTGTGCCAAGGCAGGTTATGGGGGTTACCTTTATCCACAATTCTACGACCATTCTTGC
CCCAAGGCTCAAGAGATAGTGAAGTCCGTGGTGGCCAAGGCCGTTGCGAAAGATCCTCGCATGGGCGCTTCACTTCTCCGCTTACATTTCCACGATTGCTTCGTTAAG
GTCAGCGGCTAC
GCAATTACTTGGAGTAAATAAGTTTCCACGTCTAATCTTTGGTTTCAAAAAGTTGCAAAAATAGTTTCTTATACATGTACTCTAAGTCAGCACTCCATGCGAAGAGTAAACAATCTCGTC
GATCATTTTTCCTGGTTTAGAAGCTTTCTCGATGCTTCCAGTGCATTAACTGCTCGTCATAGCACAACAAAGCATTTCTTATCGCCACTGTCAGGAGTAATTTGTACTTACATTATGCTT
CCTACTAGAACATGTTTATAATATGCTCTGTCTAAGTACCAACGTTGTCGATGTATGTGACAGGGCTGCGACGCATCCTTATTGCTGGACAGCAGCGGCACTATAATCAGTGAGAAGCGG
TCCGTCCCTAACACGAACTCAGCCAGAGGCTTTGAAGTGCTTGATGAGATCAAATCTGCACTGGAGAAGGAGTGCCCTCAAACAGTGTCTTGTGCTGACCTGTTGGCCTTGGCTGCTAGA
GACTCCACTGTTCTT
GTAAGCATATGTAGATACAGTAGTGCCCAACTTCTCTCAGCAAGAATTTCAACTTTTCACCCAAGAAAAAACCAGGAAAAAAGAAAAGCAAAATAATAATAATAA
TAATAATTTGAAATGCCTAACGAGCATAAATCAATGCTTGAATGTGTAAACAGACTGGTGGGCCTAGCTGGGTAGTGCCACTGGGAAGGAGGGACTCAACAGGAGCAAGCTTGAGTGGCT
CTAACAACAACATTCCTGCTCCAAACAACACTTTCCAGACCATTCTCACCAAGTTCAAGCTTAAAGGACTTGATATTGTTGATCTTGTCGCCCTCTCCG
GTAAAATAATTGGAATTTCTT
GACCTTAGTTTTGATTATAGCATTCGAGTCCAAGTTAGGGAAAATAAAATTGTTGGAAATGTCCCGTTACACAGGAAGCCACACAATTGGAAATGCAAGATGCACCACCTTCAGGCAGAG
GCTCTACAACCAGACAGGCAACGGGCAGCCCGACTTCACGCTCGACCAATCCTACGCCGCTCAGCTCCGCACCCGCTGCCCACGGTCCGGGGGCGACCAGAACCTCTTCTTCTTGGACTT
TGTCAGCCCGATAAAGTTCGACAACAGCTACTTCAAGAACCTGCTGGCTAAGAAGGGGCTCTTGAGCTCCGACGAAGTCCTCGTGACGCAGAGCCAGGCCACGCTGCAGCTGGTGAAGCA
GTATGCGGGGAACCAAGAGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCACCCCACTGACAGGGTCCAAGGGACAGATCAGGAAGCGTTGTAGGCAGGTCAA
TAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCAATCCAAGAACTTCCTCATCATTTTCTGTGTTCTTGCTCTGGCTCCACTCGGTCTCTGTGCCAAGGCAGGTTATGGGGGTTACCTTTATCCACAATTCTACGACCATTCTTGC
CCCAAGGCTCAAGAGATAGTGAAGTCCGTGGTGGCCAAGGCCGTTGCGAAAGATCCTCGCATGGGCGCTTCACTTCTCCGCTTACATTTCCACGATTGCTTCGTTAAG
GGCTGCGACGCA
TCCTTATTGCTGGACAGCAGCGGCACTATAATCAGTGAGAAGCGGTCCGTCCCTAACACGAACTCAGCCAGAGGCTTTGAAGTGCTTGATGAGATCAAATCTGCACTGGAGAAGGAGTGC
CCTCAAACAGTGTCTTGTGCTGACCTGTTGGCCTTGGCTGCTAGAGACTCCACTGTTCTT
ACTGGTGGGCCTAGCTGGGTAGTGCCACTGGGAAGGAGGGACTCAACAGGAGCAAGCTTG
AGTGGCTCTAACAACAACATTCCTGCTCCAAACAACACTTTCCAGACCATTCTCACCAAGTTCAAGCTTAAAGGACTTGATATTGTTGATCTTGTCGCCCTCTCCG
GAAGCCACACAATT
GGAAATGCAAGATGCACCACCTTCAGGCAGAGGCTCTACAACCAGACAGGCAACGGGCAGCCCGACTTCACGCTCGACCAATCCTACGCCGCTCAGCTCCGCACCCGCTGCCCACGGTCC
GGGGGCGACCAGAACCTCTTCTTCTTGGACTTTGTCAGCCCGATAAAGTTCGACAACAGCTACTTCAAGAACCTGCTGGCTAAGAAGGGGCTCTTGAGCTCCGACGAAGTCCTCGTGACG
CAGAGCCAGGCCACGCTGCAGCTGGTGAAGCAGTATGCGGGGAACCAAGAGCTCTTCTTCGAGCAGTTCGCCAAGTCCATGGTCAAGATGGGCAACATCACCCCACTGACAGGGTCCAAG
GGACAGATCAGGAAGCGTTGTAGGCAGGTCAATAAATAA

Retrieve as FASTA