Entry information : OsPrx39
Entry ID 1049
Creation 2005-07-20 (Filippo Passardi)
Last sequence changes 2005-07-20 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx39
Name OsPrx39
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Pannicles
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx39
start..stop
S start..stop
SbPrx20 533 0 9..333 15..337
SiPrx145 529 0 12..333 16..340
ZmPrx25 525 0 6..333 10..336
BdiPrx46 524 0 4..333 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7094289..7094510 222 N° 2 7093996..7094187 192 N° 3 7093249..7093414 166 N° 4 7092506..7092927 422
complement(join(7092506..7092927,7093249..7093414,7093996..7094187,7094289..7094 510))


exon

Literature and cross-references OsPrx39
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q4
DNA ref. GenBank:   NC_008396.1 (7094510..7092509)
Protein sequence: OsPrx39
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (306)
PWM (Da):   %s   35348.95 (33045.6) Transmb domain:   %s   i5-27o
PI (pH):   %s   8.48 (8.32) Peptide Signal:   %s   cut: 28 range:28-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAVAAVRAAVLVVAVALAAAAAGASAQLCDKYYDGTCPDVHRIVRRVLKRARQDDPRIFASLTRLHFHDCFVQGCDASILLDNSTSIVSEKFATPNNNSARGYPVVDDIKAALEEACPGVVSCADILAIAAKISVELSGGPRWRVPLGRRDGTTANLTGADNNLPSPRDNLTTLQQKFAAVGLDVTDLVALSGAHTFGRVQCQFVTDRLYNFSGTGKPDPTLDAGYRRALAKSCPRRGGNSSALNDLDPTTPDAFDKNYFANIEVNRGFLQSDQELLSTPGAPTAAIVNSFAISQKAFFKSFARSMVNMGNIQPLTGSQGEVRKSCRFVNGS

Retrieve as FASTA  
Remarks chromosome 3. 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCTGTGGCTGCGGTTCGTGCCGCGGTCCTGGTCGTGGCCGTGGCCCTCGCCGCGGCGGCGGCCGGCGCGTCGGCGCAGCTGTGCGACAAGTACTACGACGGGACGTGCCCGGAC
GTGCACCGGATCGTGCGGCGCGTGCTGAAGAGGGCGCGGCAGGACGACCCCCGCATCTTCGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GTGAGCTAGCTATTGCCA
CACCATTGCCGGCGTGCACGCGCGCACTCGTACGCCGCGCCACGCAGGATGTTCGTCTGACGCGACGTTTCCGTTTTTTCCAGGGTTGCGACGCGTCGATCCTGCTGGACAACAGCACGA
GCATCGTGTCGGAGAAGTTCGCGACGCCGAACAACAACTCGGCGCGGGGGTACCCGGTGGTGGACGACATCAAGGCGGCACTTGAGGAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACA
TCCTCGCCATCGCCGCCAAGATCTCCGTCGAACTG
GTATGTGTACGCTCGCGAGAAATCGATCTGCCGGCGCGAAGTATATATATACGTGCATATGCTTTGCACGTAAACCCGTCATTAT
CTCCCGATAACAATCGCACGTCAACTTCATTGGAAGCTAACCAACGAAGCAGTTTAGCTACGTTCTTTCACATACTTTTCACGCCAGCATAGTGACAAATTAACGTACTGGCAAGCTAGT
AGTTCGTGCTAGCTTTATCTCCAGTAGAAAGGTTGACGCTACAGCCTACAATATGCCCGTGACTGGGCTGGGAACTGGACTGGAGCGAGACATAAAGCTAGCTAGACGTCGGTGCCAAAT
AATTGAACCGCAATGCTGCAGATAGATCATAATCTCACCAACATTAACCGTCTGTAAAAAAATAATAATCCTATGAGCACCAAAAAACAGAGACCACATGGTACGACGTGGATTATGTCC
TCGCACACATCATGTGGCATCGGCTGTGTCGACGACCAGACGTCGAGATCCCACACCAAATCCCTTCTTTTCGTGCCGCACTTTACTCCAACACGGCCACATGACGCCCACAATGTCCGT
GTGTCAATGCGTGCAGTCCGGAGGCCCCCGGTGGCGCGTGCCCCTCGGCCGGCGCGACGGCACCACGGCCAACCTCACCGGCGCCGACAATAACCTCCCCAGCCCCCGCGACAACCTCAC
CACCCTTCAGCAGAAGTTCGCCGCCGTCGGCCTCGACGTCACCGACCTCGTCGCCCTCTCAG
GTAAATAAACAGAGTAACAGATAGGGAGATAACGTACGACGCTACCTACTGCTCCCTC
CGAACCAGATTATAAAACGTTAGACTTTGATTAATTTTATAGATAAATATAGTAATATTTATAATACTAAATTAGTTTCATTAAATCAATAATTGAATATATTTTTATAATAAATTTGTC
TTGTGTTAAAAATATTACTATTTTTTTACAACTTAAAGCAGTTTGACTTTGATCAAAGTTAAAATGTCTTATAACTTGAAACGGAGGGAATAGCAATCAACTGAAACTGAAAATTGTGGG
TGAAAATGAATGTAAATGGGCAGGGGCGCACACGTTCGGGAGGGTGCAGTGCCAGTTCGTGACGGACAGGCTGTACAACTTCAGCGGGACGGGGAAGCCGGACCCGACGCTGGACGCCGG
CTACCGGCGGGCGCTGGCGAAGAGCTGCCCGCGGCGGGGCGGGAACTCGTCGGCGCTGAACGACCTGGACCCGACCACGCCGGACGCCTTCGACAAGAACTACTTCGCCAACATCGAGGT
GAACCGCGGCTTCCTCCAGTCCGACCAGGAGCTCCTGTCCACGCCGGGCGCGCCCACGGCGGCGATCGTCAACAGCTTCGCCATCAGCCAGAAGGCCTTCTTCAAGAGCTTCGCCAGGTC
CATGGTCAACATGGGGAACATCCAGCCGCTGACGGGCAGCCAGGGGGAGGTCCGGAAGAGCTGCAGATTTGTCAATGGAAGTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCTGTGGCTGCGGTTCGTGCCGCGGTCCTGGTCGTGGCCGTGGCCCTCGCCGCGGCGGCGGCCGGCGCGTCGGCGCAGCTGTGCGACAAGTACTACGACGGGACGTGCCCGGAC
GTGCACCGGATCGTGCGGCGCGTGCTGAAGAGGGCGCGGCAGGACGACCCCCGCATCTTCGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTCCAG
GGTTGCGACGCGTCGATC
CTGCTGGACAACAGCACGAGCATCGTGTCGGAGAAGTTCGCGACGCCGAACAACAACTCGGCGCGGGGGTACCCGGTGGTGGACGACATCAAGGCGGCACTTGAGGAGGCCTGCCCCGGC
GTCGTCTCCTGCGCCGACATCCTCGCCATCGCCGCCAAGATCTCCGTCGAACTG
TCCGGAGGCCCCCGGTGGCGCGTGCCCCTCGGCCGGCGCGACGGCACCACGGCCAACCTCACCGGC
GCCGACAATAACCTCCCCAGCCCCCGCGACAACCTCACCACCCTTCAGCAGAAGTTCGCCGCCGTCGGCCTCGACGTCACCGACCTCGTCGCCCTCTCAG
GGGCGCACACGTTCGGGAGG
GTGCAGTGCCAGTTCGTGACGGACAGGCTGTACAACTTCAGCGGGACGGGGAAGCCGGACCCGACGCTGGACGCCGGCTACCGGCGGGCGCTGGCGAAGAGCTGCCCGCGGCGGGGCGGG
AACTCGTCGGCGCTGAACGACCTGGACCCGACCACGCCGGACGCCTTCGACAAGAACTACTTCGCCAACATCGAGGTGAACCGCGGCTTCCTCCAGTCCGACCAGGAGCTCCTGTCCACG
CCGGGCGCGCCCACGGCGGCGATCGTCAACAGCTTCGCCATCAGCCAGAAGGCCTTCTTCAAGAGCTTCGCCAGGTCCATGGTCAACATGGGGAACATCCAGCCGCTGACGGGCAGCCAG
GGGGAGGTCCGGAAGAGCTGCAGATTTGTCAATGGAAGTTAA

Retrieve as FASTA