Entry information : EgrPrx169
Entry ID 10492
Creation 2012-02-09 (Qiang Li)
Last sequence changes 2016-03-10 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-01-29 (Christophe Dunand)
Peroxidase information: EgrPrx169
Name EgrPrx169
Class Class III peroxidase    [Orthogroup: Prx136]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx169
start..stop
S start..stop
EcamPrx188 622 0 1..320 1..319
EcamPrx200 616 0 1..320 1..320
EglPrx[P]169 565 0 1..320 1..339
EcamPrx[P]169 558 0 1..320 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40..258 219 N° 2 796..987 192 N° 3 1077..1628 552  
join(40..258,796..987,1077..1628)


exon

Literature and cross-references EgrPrx169
DNA ref. Phytozome 12:   scaffold_11 (15933581..15934950)
Cluster/Prediction ref. Genebank:   104425097
Protein sequence: EgrPrx169
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (295)
PWM (Da):   %s   34306.13 (31518.7)  
PI (pH):   %s   8.32 (7.70) Peptide Signal:   %s   cut: 26 range:26-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNTNRKIYFVFFVCAIALRSALAQLSNQDYYTQRCPRALETIQSAVRSAVANETRMGASLLRLHFHDCFVNGCDASILLDDTVNFTGEKTAFPNVNSVRGFDVIDTIKLKVEKLCPGIVSCADILAVAARDSVVILDGPSWQVQLGRRDSTTASLNDANIDLPAPTLNLSGLVASFSNKGFTAKEMVTLSGSHTIGQARCVTFRTRLYNESNISPSFAMSLKSNCPSSGGNNNLSPLNITSPTFFDNAYFGNLVSQEGLLHSDQQLFSGGSTNAQVAAYSKNLGSFRNDFADAMVKMGGLSPLTGSSGQIRTNCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (). No prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGTCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
CTGGAGACCATCCAATCTGCTGTGAGATCGGCGGTGGCCAACGAGACTCGCATGGGAGCATCCTTGCTCCGACTTCACTTTCACGATTGCTTTGTCAAT
GCAAGTCTCTTCCGCTTTCTC
GCTCAGTTCTATCCTTTTTCCTTCATGTCCAGTTTCGTGTATGTTTTGCATGTTCTTTTACGTGCAAACTTTTACTTCATTCCCAATCCATATAAGGATTACTCTTCCTCCACGTTTATT
TTCGATGGTTCCTCGCATGTCTGCTTAATTCACTCCTGATTGAAAATGGCCAACATTTTGGAGATTCGGATCTTTGAGGAATATTGCAACAAGTGAGCTACGTGGGCCAATGATTCCATT
AAATTAAGAAAGAACACGCATTGAGCTGATCATAGCACACCATTTAGACGACCTGCCAATCTTGTGTCTCTGACTATGTCTTTTTTTCATGCAATATAAATTTGTCTCCATATCTTATTC
TATTCTAACCGATGAATTTTCTCTCTTAACGTTCCTTTCCGGTTGCTTGCAAAAAAAAAAAAATTATTTTGTTTCCTCATAGGTTCAATATTTAGATCATCCTTTCTAGTTCGTTAGATC
TTCTAAACTTAATAAGATTAATATATATATTTATAGGGATGTGATGCATCCATTCTACTAGATGACACCGTGAACTTCACTGGGGAGAAGACAGCGTTTCCCAACGTGAACTCCGTGAGG
GGATTCGATGTGATTGACACCATCAAGTTAAAAGTGGAGAAACTGTGTCCTGGCATTGTCTCGTGCGCTGACATCTTAGCCGTTGCTGCTAGGGACTCCGTCGTCATT
GTAAGCATTGAC
ACTTGCAATTTCTTTAAACATACAAAGAAACTATTATTTTCCTAAACTTATGTGGATTCAATTAATTTGATGTTTAGTTGGATGGACCGAGTTGGCAAGTCCAACTGGGAAGAAGAGACT
CAACCACAGCGAGCCTAAATGATGCTAATATCGACCTCCCAGCTCCAACTCTTAATCTCAGCGGTCTTGTCGCCTCTTTCTCTAACAAAGGCTTTACTGCCAAAGAAATGGTAACGCTAT
CAGGATCCCACACCATAGGCCAGGCTAGGTGCGTGACGTTTCGGACCCGACTCTACAACGAGAGCAATATAAGCCCATCATTCGCCATGTCTTTAAAGTCCAATTGCCCCAGCTCTGGAG
GCAACAACAACCTATCCCCTCTCAACATCACAAGCCCGACGTTCTTTGACAATGCCTACTTCGGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGATCAACAGTTGTTTAGTGGAG
GTTCGACGAATGCTCAAGTGGCTGCCTACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCTTACCGGGTCTAGCGGTCAGA
TCAGGACCAATTGCAGAAAAGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAAACCGGAAGATCTACTTCGTCTTCTTTGTTTGTGCGATCGCGTTGAGGTCCGCCTTGGCGCAATTGTCTAACCAAGACTACTACACGCAAAGGTGCCCGAGAGCA
CTGGAGACCATCCAATCTGCTGTGAGATCGGCGGTGGCCAACGAGACTCGCATGGGAGCATCCTTGCTCCGACTTCACTTTCACGATTGCTTTGTCAAT
GGATGTGATGCATCCATTCTA
CTAGATGACACCGTGAACTTCACTGGGGAGAAGACAGCGTTTCCCAACGTGAACTCCGTGAGGGGATTCGATGTGATTGACACCATCAAGTTAAAAGTGGAGAAACTGTGTCCTGGCATT
GTCTCGTGCGCTGACATCTTAGCCGTTGCTGCTAGGGACTCCGTCGTCATT
TTGGATGGACCGAGTTGGCAAGTCCAACTGGGAAGAAGAGACTCAACCACAGCGAGCCTAAATGATGCT
AATATCGACCTCCCAGCTCCAACTCTTAATCTCAGCGGTCTTGTCGCCTCTTTCTCTAACAAAGGCTTTACTGCCAAAGAAATGGTAACGCTATCAGGATCCCACACCATAGGCCAGGCT
AGGTGCGTGACGTTTCGGACCCGACTCTACAACGAGAGCAATATAAGCCCATCATTCGCCATGTCTTTAAAGTCCAATTGCCCCAGCTCTGGAGGCAACAACAACCTATCCCCTCTCAAC
ATCACAAGCCCGACGTTCTTTGACAATGCCTACTTCGGCAACTTGGTGAGCCAAGAGGGCCTGCTTCATTCGGATCAACAGTTGTTTAGTGGAGGTTCGACGAATGCTCAAGTGGCTGCC
TACAGCAAAAATTTGGGTTCATTCAGGAATGATTTTGCCGATGCCATGGTCAAGATGGGAGGCCTTAGTCCTCTTACCGGGTCTAGCGGTCAGATCAGGACCAATTGCAGAAAAGTCAAT
TGA

Retrieve as FASTA