Entry information : EgrPrx88 ( Eucgr.E04121 / Egrandis_v1_0.037732m)
Entry ID 10508
Creation 2012-02-15 (Qiang Li)
Last sequence changes 2016-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-15 (Achraf Jemmat)
Peroxidase information: EgrPrx88 ( Eucgr.E04121 / Egrandis_v1_0.037732m)
Name (synonym) EgrPrx88 ( Eucgr.E04121 / Egrandis_v1_0.037732m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx88
start..stop
S start..stop
EgrPrx82 669 0 1..327 1..327
EglPrx82 668 0 1..327 1..327
EcamPrx82 663 0 1..327 1..327
EguPrx82 651 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 64872933..64873157 225 N° 2 64873419..64873604 186 N° 3 64873877..64874042 166 N° 4 64874220..64874626 407
join(64872933..64873157,64873419..64873604,64873877..64874042,64874220..64874626 )


exon

Literature and cross-references EgrPrx88 ( Eucgr.E04121 / Egrandis_v1_0.037732m)
DNA ref. GenBank:   NW_010092442.1 (64872933..64874626) Phytozome 12:   scaffold_5 (70625088..70622207)
Cluster/Prediction ref. Genebank:   104445533
Protein sequence: EgrPrx88 ( Eucgr.E04121 / Egrandis_v1_0.037732m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35399.27 (32284.6)  
PI (pH):   %s   8.69 (8.90) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLVQLMFLFLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVIGQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTNQAEKDAPPNFSLRGYQVIDRVKTALEKACPGIVSCADVLAIVARDVIVATRGLSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSDRLYNFTGKGDTDPKLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDAALLDDSQTKAFIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGGTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATTGGTCAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GTAAGTGAATGAATG
AGCGCACGTACTTCTCTTCCTACTTGTGCTTAGGAAGAGTACTATCTTATGAGCACCTGTATAATGACTGAAAAGAATGGTTTTTACTTTCGTCGAACCATCTGCTAAACATCAATTAGA
ACAGGTTATAATCTAACGAATGGTGTTTAGCCCCTCAACATACTTTTCTAGATTCGTCCGTGGATACGAACTGTTTTCTGCGTGAACTCACAGTTGAATAGTGTTTCTTTCTGGGTTCTT
CCACAGGGTTGCGAAGGTTCAATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTG
GAGAAGGCATGTCCCGGCATCGTTTCGTGTGCTGACGTTTTGGCCATCGTCGCAAGAGATGTCATAGTCGCG
GTACGCATATGCATATGTCACATGCATTATTTATTCATTCTAATTTTA
ATGTTCCTCATTTACATATGACATCTGTAGAAATCTCGATTTTCACAAACAATCCATGCTCTCTCGTTGGAAAAAATACTCCGCCCATACTTATCTTCGGAGCTAATTACTGCTTGTCAA
AACCGAGATTATTTTTTCGTCGTGCATCATAAAACTCAATGATTTTTCCATAAGAGAAAAACATATTTATATAGGAATTGAGTTTCTTTTTGTTGTCACTTTAGACCAGAGGCCTTTCCT
ATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAATGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACCCTGAAAGCAGATTTTGCAATGAGAGGCC
TCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTAATACCTAATCTTCAATTATTGCTTCATATGCTTTATCAATTATTTTGTGGAAATTGACATAAATTAATAGGAAGAACTATAATTTGA
GCACGAGATTCATAAACAGTCTGCACTGCGAGGAGAAAACGTAATTTGTAAAGTTAGATCATGATAATTCTGATTTCTATTGACCAGGTGGCCACACCCTTGGAACTTCACACTGCTCTT
CCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTAAAGCTCAAGTGCAAGCCGAATGACCAAACCACCCTCGTTG
AGATGGACCCAGGAAGCGTGAGGACTTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCCAAACCAAGGCATTCA
TTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGGAAAGTGTGTG
CAAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGGTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATTGGTCAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GGTTGCGAAGGTTCA
ATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCATC
GTTTCGTGTGCTGACGTTTTGGCCATCGTCGCAAGAGATGTCATAGTCGCG
ACCAGAGGCCTTTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAATGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACCCTGAAAGCAGATTTTGCAATGAGAGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTAAAGCTCAAGTGCAAGCCGAATGACCAAACC
ACCCTCGTTGAGATGGACCCAGGAAGCGTGAGGACTTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCCAAACC
AAGGCATTCATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGG
AAAGTGTGTGCAAAGGTTAATTAA

Retrieve as FASTA