Entry information : PoVP05_PC9 (VP4)
Entry ID 10514
Creation 2012-02-21 (Christophe Dunand)
Last sequence changes 2016-06-10 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-10 (Catherine Mathe)
Peroxidase information: PoVP05_PC9 (VP4)
Name (synonym) PoVP05_PC9 (VP4)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoVP05_PC9
start..stop
S start..stop
PsaVP01 713 0 1..361 1..361
PoVP05_PC15 711 0 1..358 1..358
PerVP05_CBS458 689 0 1..361 1..361
PerVP05-1_CBS613 685 0 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 536530..536592 63 N° 2 536648..536784 137 N° 3 536840..536898 59 N° 4 536952..537086 135
N° 5 537137..537258 122 N° 6 537315..537390 76 N° 7 537443..537479 37 N° 8 537538..537545 8
N° 9 537594..537674 81 N° 10 537730..537799 70 N° 11 537858..537867 10 N° 12 537918..537953 36
N° 13 538018..538190 173 N° 14 538244..538283 40 N° 15 538357..538381 25 N° 16 538448..538460 13
join(536530..536592,536648..536784,536840..536898,536952..537086,537137..537258, 537315..537390,537443..537479,537538..537545,537594..537674,537730..537799,53785 8..537867,537918..537953,538018..538190,538244..538283,538357..538381,538448..53 8460)


exon

Literature and cross-references PoVP05_PC9 (VP4)
DNA ref. JGI genome:   scaffold_8 (536529..538460)
EST ref. GenBank:   HS531827.1 [5' end]   HS540715.1 [3' end]
Cluster/Prediction ref. JGI gene:   116738
Protein sequence: PoVP05_PC9 (VP4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   362 (339)
PWM (Da):   %s   37729.89 (35421.6)  
PI (pH):   %s   4.35 (4.30) Peptide Signal:   %s   cut: 23 range:23-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKTLSALVLALGAAIQFTSAAVPLVQKRATCADGRTTANAACCVLFPILDDIQENLFDGAQCGEEVHESLRLTFHDAIGFSPTGGGGADGSIITFDTIETNFPANAGIDEIVSAQKPFVAKHNISAGDCIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPFDSVDTILARMGDAGFSAVEVVWLLWHSIAAADKVDPSIGTPFDSTPGVFDSQFFIETQLKGRLFPGTPDNKGEVQSPLQGEIRLQSDHLLARDPQTACEWQSMVDNQPKIQNRFAGTMSKMALLGQDKSKLIDCSDIIPTPPALVGAAHLPAGFSLSDVEACAETPFPALTADPGPVTSVPGPGX

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns) and 6 ESTs. Strain="N001 and PC9".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCCGCTCTTGTGCTTGCGCTCGGCGCCGCTATCCAGTTCACGAGTGGTGGGCTTCGTCTCTGACTACGATGTCGAGGCAACCTTGCTGACTGGTGTTTCAGC
TGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGCCGATGGACGCACCACCGCAAATGCTGCATGTTGCGTTCTGTTCCCCATCCTGGATGACATCCAGGAAAACCTCTTCGACGGTGC
CCAGTGTGGAGAAGA
GGTGCTATACTTATTGTCCTAATGCAGAACGGCTATTAATTCACGCGCGTACACAGGTACACGAGTCCCTTCGTTTGACTTTCCACGATGCAATCGGTTTCTCTC
CTACTTTAG
GGTAAGGTAACGATCATCACCCGTGTTGTCTATTATCTAACCTATGCACAACAGGGGAGGAGGAGCTGACGGCTCCATCATCACATTCGACACCATTGAGACCAATTTCCC
CGCCAATGCTGGCATCGATGAAATTGTCAGCGCTCAGAAGCCATTCGTGGCTAAACACAACATCTCCGCCGGCGACT
TGTAAGCATTTCATGTTAGAGGTTAAAGTGACCCTTACCAAAC
AATTCTAGCATTCAATTTGCTGGTGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCATTCTTCTTGGGTCGCCCGGATGCCGTAGCCGCCTCCCCGGACCACCTCGTGCCA
GAGCCTTTT
GGTACGTTTGGATACGGTAATATTATTGACGAGAACTGAGGGTGTGGGTTCGCCTAGATTCTGTTGACACTATTCTTGCCAGAATGGGTGACGCAGGCTTCAGTGCCGTCG
AGGTCGTTTGGCTCCTGGCTT
CGTGAGTGCATGGAGAGATGTAAGCACCACCATCGATCTAACTTGTAGCCTAGGCACTCCATTGCCGCTGCCGACAAGGTTGACCCATCGGTAAGTCGA
GTTGCACTGGCAAGTTTATTGTAAAGGCTAATACCTTATAATTGTCTAGATTCCTGGGTAAGAACGAACATCCACTGGCGCGGTCAGCTACTGACTTCATGTCAGAACGCCATTCGATTC
AACCCCCGGAGTTTTTGATTCTCAGTTCTTCATCGAAACGCAACTTAAAGGCAGACTCTTTCCAG
GGTAAGTGATTCCATTTCTGACTCACCAAAATATGACCCGCTCAGGTTGTATCTA

GTACTCCTGACAACAAGGGAGAAGTCCAATCTCCATTGCAAGGGGAGATCAGGCTTCAGTCAGATCACTT
GGTGAGGCCATTTCAGTTCATTATTCAACTAGTGATACTGACAAATATCT
ATCGGATAGTTGGCTAGAGGTACGAGTCTTCCTTGCAGCCTTTGATGTCGATGCTCATAGCCTCCAAAGACCCCCAGACTGCCTGCGAATGGCAGTCCATGGTTAGTGAGTAAAATATTG
CCTTTCATACTGTGTAACGCAGAGGCTGACTAAATCGCCCTACTACCAGACAACCAGCCGAAGATTCAGAACCGCTTCGCTGGTACCATGTCGAAGATGGCTCTTCTTGGCCAGGACAAG
AGCAAACTGATTGATTGCTCTGATATTATCCCCACCCCTCCTGCCCTTGTCGGAGCGGCCCACTTGCCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGC
GGTACGTGCACTTGTTTCC
CTGGATAAATGAGGGTCCTCACGATCTGTGATCAGTGCGCCGAGACGCCTTTCCCTGCTCTTACTGCTGACCCAGGTGAATACATGCGGTGTTAACATTTTATCGCCGCGCTATTTGAAC
TGACTGGTATATCTCTTCGTTTTCTCAGGCCCAGTAACCTCTGTCCCTCCCGTGTAAGTTTTTAGTCACCCTAGTCACCCAATATGTCAAGGCGCGCTCATTGTCTACGTCTCCTACAGC
CCTGGATCGTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAGACGCTCTCCGCTCTTGTGCTTGCGCTCGGCGCCGCTATCCAGTTCACGAGTGCTGCTGTGCCTCTCGTCCAGAAACGCGCAACTTGCGCCGATGGACGCACCACCGCA
AATGCTGCATGTTGCGTTCTGTTCCCCATCCTGGATGACATCCAGGAAAACCTCTTCGACGGTGCCCAGTGTGGAGAAGA
GGTACACGAGTCCCTTCGTTTGACTTTCCACGATGCAATC
GGTTTCTCTCCTACTTTAG
GGGGAGGAGGAGCTGACGGCTCCATCATCACATTCGACACCATTGAGACCAATTTCCCCGCCAATGCTGGCATCGATGAAATTGTCAGCGCTCAGAAGCCA
TTCGTGGCTAAACACAACATCTCCGCCGGCGACT
GCATTCAATTTGCTGGTGCCGTTGGAGTCTCCAACTGCCCTGGTGGTGTCAGGATTCCATTCTTCTTGGGTCGCCCGGATGCCGTA
GCCGCCTCCCCGGACCACCTCGTGCCAGAGCCTTTT
GATTCTGTTGACACTATTCTTGCCAGAATGGGTGACGCAGGCTTCAGTGCCGTCGAGGTCGTTTGGCTCCTGGCTTGGCACTCC
ATTGCCGCTGCCGACAAGGTTGACCCATC
GATTCCTGGAACGCCATTCGATTCAACCCCCGGAGTTTTTGATTCTCAGTTCTTCATCGAAACGCAACTTAAAGGCAGACTCTTTCCAGGT
ACTCCTGACAACAAGGGAGAAGTCCAATCTCCATTGCAAGGGGAGATCAGGCTTCAGTCAGATCACTT
GTTGGCTAGAGACCCCCAGACTGCCTGCGAATGGCAGTCCATGGTTGACAAC
CAGCCGAAGATTCAGAACCGCTTCGCTGGTACCATGTCGAAGATGGCTCTTCTTGGCCAGGACAAGAGCAAACTGATTGATTGCTCTGATATTATCCCCACCCCTCCTGCCCTTGTCGGA
GCGGCCCACTTGCCGGCGGGATTTTCTCTTAGCGATGTAGAGCAAGC
GTGCGCCGAGACGCCTTTCCCTGCTCTTACTGCTGACCCAGGCCCAGTAACCTCTGTCCCTCCCGGCCCTGGA
TCGTA

Retrieve as FASTA