Entry information : PoCIIBA03_C9 (MnP4)
Entry ID 10517
Creation 2012-02-22 (Christophe Dunand)
Last sequence changes 2012-02-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-08-22 (Nizar Fawal)
Peroxidase information: PoCIIBA03_C9 (MnP4)
Name (synonym) PoCIIBA03_C9 (MnP4)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoCIIBA03_C9
start..stop
S start..stop
PoCIIBA03_PC15 743 0 1..365 1..365
ParcCIIBA06 488 2e-174 20..365 15..361
ParcCIIBA04 484 6e-173 28..362 26..361
PoCIIBA02_C9 482 5e-172 25..362 20..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2703196..2703362 167 N° 2 2703414..2703433 20 N° 3 2703487..2703512 26 N° 4 2703571..2703629 59
N° 5 2703690..2703703 14 N° 6 2703759..2703879 121 N° 7 2703942..2704236 295 N° 8 2704292..2704398 107
N° 9 2704458..2704495 38 N° 10 2704546..2704718 173 N° 11 2704778..2704842 65 N° 12 2704901..2704913 13
join(2703196..2703362,2703414..2703433,2703487..2703512,2703571..2703629,2703690 ..2703703,2703759..2703879,2703942..2704236,2704292..2704398,2704458..2704495,27 04546..2704718,2704778..2704842,2704901..2704913)


exon

Literature and cross-references PoCIIBA03_C9 (MnP4)
DNA ref. JGI genome:   scaffold_1 (2703196..2704913)
Protein sequence: PoCIIBA03_C9 (MnP4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (342)
PWM (Da):   %s   39005.73 (36628.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   6.04 (5.87) Peptide Signal:   %s   cut: 24 range:24-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVNSFHSLLSTIALALLVPSVLAVPAHRAKCSKGRTASNDACCVWFDVLDDIQENLFDGGEGEEVHESLLTFHDAIGFSPALTRQGKFGGGGDGSIMLFSDIETNFAANNGVDDIVEQQKPIAIKHQVSFGDFIQFAGAVGSSNCAGGPRIQFLAGRSNVTKPSPDHLVPEPFDSVTSILARMGDAGFKPDEVVALLASHSVAAQDTIDPKLAGHPFDSTPSDFDSQFFVTLLKGTLIPGDSLHKGQVKSPLPGEFRLQSDELLARDSRTSCEWQSFSNPNSMVPKFERAMAKMATLGQNPKKLIDCSEVIPVPRGRVKQPTLPAGKTIKDIEACRKAPFPRLPTDKGTFTSILPVPSS

Retrieve as FASTA  
Remarks Commplete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAACTCATTCCACTCACTCTTGAGCACCATTGCTCTTGCTCTGCTGGTCCCTTCGGTTCTCGCCGTCCCAGCTCACCGCGCAAAATGCAGCAAGGGAAGGACAGCAAGCAATGAC
GCGTGCTGTGTGTGGTTCGATGTCCTCGATGACATCCAAGAGAACCT
GTGAGATATGCATATTACCTGTGTTTATTGCTGTCTAACCTTGGTCAACAGCTTTGACGGCGGAGAGTGCGGT
ATGCACCTTGTCAATCCATTGGCACAGCCGTATACTGACTTCTGACTTCAGGCGAAGAGGTCCACGAATCCTTGAGGGTATGGCAAATGACTCCTCTGTTGTATCGAGATTCGACGCTTA
TACTATGTGGTATAGCTGACGTTCCACGACGCCATCGGATTCTCGCCTGCCCTGACTAGACAAGGCAAATTCGGGTCAGTATTCTCTTTCCAATAGTGATGTTGTCCATTTATTGATGTG
TGGTTTCTGAACAGTGGCGGCGGCGCTGGTAAGACACAATGAATCTCGGTCCATGATCAACACTAACGAGATATGTTGAAAAGACGGATCCATCATGCTCTTCTCAGACATTGAGACTAA
TTTCGCGGCCAACAATGGTGTTGATGACATTGTCGAGCAGCAAAAGCCGATCGCCATCAAACACCAGGTCTCGTTCGGTGATTT
GTATGTACTGTTCATCGGCTGTTTGACATATCGGCT
ATATGAAACTGATATGTCTCCCGCAGCATCCAGTTCGCAGGCGCTGTTGGCTCGTCCAACTGCGCCGGAGGGCCACGTATCCAGTTTTTGGCGGGTCGCTCTAATGTCACGAAGCCGTCC
CCCGACCACTTGGTGCCCGAGCCCTTTGATTCTGTTACCAGTATCCTTGCCCGCATGGGAGATGCTGGATTTAAGCCTGATGAAGTCGTTGCTTTGCTAGCCTCGCACTCCGTCGCAGCT
CAGGATACTATCGACCCCAAGCTTGCTGGGCACCCCTTTGATTCAACGCCATCCGACTTTGATTCGCAGTTCTTCGTTGAG
GTTTGTCTTGATAGGATAAACTCCTTCCTTGCTGTCGGT
TGACGATGGCTTTTAGACACTTTTGAAGGGAACTCTTATTCCGGGTGACTCCCTCCACAAGGGTCAAGTCAAGTCACCCCTTCCCGGTGAATTCAGGCTCCAGTCGGACGAACTTCTCGC
AAG
GTTTGTCCTTCTCTGTAATCCCTCTGGCGTCACCCACTTACCTTCATGACCTCCTCAAGGGACTCGCGCACTTCCTGCGAATGGCAATCCTTCATCTGTGAGTACTATTTACTCTGC
CCTTCCGTTCATATTCTGATGATTCGCCAGCCAACCCCAACTCGATGGTACCTAAATTCGAGAGGGCAATGGCCAAGATGGCGACCCTCGGACAGAACCCAAAGAAGCTGATTGACTGCT
CAGAAGTCATCCCAGTTCCCCGTGGTCGCGTCAAGCAGCCTACCCTCCCCGCTGGCAAGACCATCAAGGATATTGAAGCATCC
GTAAGCTCTCTTCGCAATGTCTATTTTTCTCTGTCAT
GCCATGCTCACTCTTCATCTAGTGCCGCAAAGCGCCCTTCCCTCGGTTGCCAACTGACAAAGGCACATTCACCAGCATCCTCCCAGTGTAAGCCATCTACCCCAAGCCGTCTCAGAATGC
GCAACTTATACCCTTCCTCTTACAGTCCTAGTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAACTCATTCCACTCACTCTTGAGCACCATTGCTCTTGCTCTGCTGGTCCCTTCGGTTCTCGCCGTCCCAGCTCACCGCGCAAAATGCAGCAAGGGAAGGACAGCAAGCAATGAC
GCGTGCTGTGTGTGGTTCGATGTCCTCGATGACATCCAAGAGAACCT
CTTTGACGGCGGAGAGTGCGGCGAAGAGGTCCACGAATCCTTGAGGCTGACGTTCCACGACGCCATCGGATTC
TCGCCTGCCCTGACTAGACAAGGCAAATTCGG
TGGCGGCGGCGCTGACGGATCCATCATGCTCTTCTCAGACATTGAGACTAATTTCGCGGCCAACAATGGTGTTGATGACATTGTCGAG
CAGCAAAAGCCGATCGCCATCAAACACCAGGTCTCGTTCGGTGATTT
CATCCAGTTCGCAGGCGCTGTTGGCTCGTCCAACTGCGCCGGAGGGCCACGTATCCAGTTTTTGGCGGGTCGC
TCTAATGTCACGAAGCCGTCCCCCGACCACTTGGTGCCCGAGCCCTTTGATTCTGTTACCAGTATCCTTGCCCGCATGGGAGATGCTGGATTTAAGCCTGATGAAGTCGTTGCTTTGCTA
GCCTCGCACTCCGTCGCAGCTCAGGATACTATCGACCCCAAGCTTGCTGGGCACCCCTTTGATTCAACGCCATCCGACTTTGATTCGCAGTTCTTCGTTGAG
ACACTTTTGAAGGGAACT
CTTATTCCGGGTGACTCCCTCCACAAGGGTCAAGTCAAGTCACCCCTTCCCGGTGAATTCAGGCTCCAGTCGGACGAACTTCTCGCAAG
GGACTCGCGCACTTCCTGCGAATGGCAATCC
TTCATCT
CCAACCCCAACTCGATGGTACCTAAATTCGAGAGGGCAATGGCCAAGATGGCGACCCTCGGACAGAACCCAAAGAAGCTGATTGACTGCTCAGAAGTCATCCCAGTTCCCCGT
GGTCGCGTCAAGCAGCCTACCCTCCCCGCTGGCAAGACCATCAAGGATATTGAAGCATCC
TGCCGCAAAGCGCCCTTCCCTCGGTTGCCAACTGACAAAGGCACATTCACCAGCATCCTC
CCAGT
TCCTAGTTCGTAA

Retrieve as FASTA