Entry information : PoCIIBA01_C9 (MnP1)
Entry ID 10522
Creation 2012-02-22 (Christophe Dunand)
Last sequence changes 2012-02-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-08-22 (Nizar Fawal)
Peroxidase information: PoCIIBA01_C9 (MnP1)
Name (synonym) PoCIIBA01_C9 (MnP1)
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Pleurotaceae Pleurotus
Organism Pleurotus ostreatus (Oyster mushroom)    [TaxId: 5322 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PoCIIBA01_C9
start..stop
S start..stop
PoCIIBA01_PC15 724 0 1..358 1..358
PoCIIBA02_C9 568 0 1..358 1..360
PoCIIBA02_PC15 568 0 1..358 1..360
ParcCIIBA04 508 0 23..358 26..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32682..32789 108 N° 2 32843..32886 44 N° 3 32937..32956 20 N° 4 33014..33030 17
N° 5 33083..33091 9 N° 6 33147..33205 59 N° 7 33267..33280 14 N° 8 33331..33372 42
N° 9 33423..33501 79 N° 10 33551..33791 241 N° 11 33845..34043 199 N° 12 34098..34273 176
N° 13 34326..34394 69  
join(32682..32789,32843..32886,32937..32956,33014..33030,33083..33091,33147..332 05,33267..33280,33331..33372,33423..33501,33551..33791,33845..34043,34098..34273 ,34326..34394)


exon

Literature and cross-references PoCIIBA01_C9 (MnP1)
DNA ref. JGI genome:   scaffold_9 (32682..34394)
Cluster/Prediction ref. JGI gene:   137764
Protein sequence: PoCIIBA01_C9 (MnP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359 (340)
PWM (Da):   %s   37866.01 (35868.9)  
PI (pH):   %s   4.77 (4.69) Peptide Signal:   %s   cut: 19 range:19-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFKALFTLTVLAVSAFAAPSKKVTCSGGRTTSDASCCVWFDVLDDIQENLFDGAEGEEVHESLLTFHDAIGFSPKLSRQGKFGGGGDGSLMAHTEIEAAFNANNGIDDIVEVQRPFAIKHKVSFGDFIQFAGAVGVSNCAGGPRLEFLAGRSNHSIASPDLLVPEPSDSVDAILARMGDAGFSPDEIVDLLASHSIAAADHVDESIGTPFDSTPSAFDAQFFLEVLLKGTLVPGNGTHTGQALSPIPGEIRIQSDFLLARDRRTACRWQSFIANERLMVSRFEKVMSKLATLGQVRSRLTDCSDVIPVPQVRLTKPVTIPAGRSMADVEACAATPFPALSADPGPVTTVPPV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (12 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAAGCTCTCTTCACTCTTACCGTGCTTGCCGTGTCCGCCTTTGCCGCTCCATCCAAGAAGGTCACTTGCAGCGGTGGAAGGACGACTAGCGATGCCAGCGTAGGTTAAAGT
TGGTTATGGCACTAACATGGCCGCTGACTGAGCAGCGATAGTGTTGCGTCTGGTTCGACGTCCTGGACGACATTCAAGAGAACCTGTGGGTCTAAAATACCCTGCGTTTTCTGTGGTTAT
TAACGTTGGTCATAGATTTGACGGTGCTGAGTGTGGCAAGTTAACTTGCTCATTTACGGTAGTCTCTTTTTTCTAACTCTTCAGAATTGCAGGCGAAGAAGTGCACGAGGTACGTTGATA
AGATATTGTCCACTTTCCACAACTAATTACATTGTCCATAGTCCCTTCGCGTGAGCTTTTCTGTTAAATCCGGACTGACCGGGCTATTCACAACGCCCCCATTAGTTGACGTTCCATGAT
GCTATCGGATTCTCCCCGAAGCTATCCCGCCAAGGAAAGTTCGG
GTAAGTGCACATGCCGTACTTTCTTTATCCACTAATCTCATCTCTTTGGGTAACTCAATAGTGGTGGAGGCGCGGG
TAGGACACTCATAGCCTAGCACATGCTCCACATTTTGACATCTTCGCAGACGGTTCTCTCATGGCACATACGGAGATCGAGGCGGCCTTCAGCAAGTGCTTTCCCCTTGGTAAACACTTG
CAGTCTAACACGGTCACGTAGATGCAAACAACGGTATCGATGACATCGTCGAGGTCCAGAGGCCCTTCGCCATCAAGCATAAAGTATCCTTTGGTGACTTGTAAGTTGCACCGCAGTGCT
CCATGGCGCAACTGCTAATTGTAAAATAGCATCCAATTTGCTGGTGCGGTTGGTGTAAGCAACTGTGCTGGAGGCCCCCGACTTGAATTCCTGGCTGGCCGTTCGAATCACTCCATCGCA
TCCCCTGACCTCCTTGTCCCCGAGCCCAGCGACTCGGTGGATGCCATATTGGCCAGAATGGGAGATGCAGGTTTCAGCCCAGACGAGATCGTTGATCTTCTTGCCTCGCACAGTATCGCA
GCAGCTGATCACGTCGATGAGAGCATCCCC
GTACGTTGTCGTCTCTTTTCAAGTAGATGTTAACCGACGCCGTCTCCTATTAGGGGACCCCGTTCGACTCTACTCCGAGCGCTTTCGATG
CGCAATTCTTCTTGGAAGTGCTTCTCAAAGGAACGCTTGTGCCAGGAAATGGCACCCACACCGGCCAGGCGCTTTCTCCTATCCCTGGTGAAATCCGCATCCAATCAGACTTCTTGCTTG
CTCGCGACAGACGCACAGCCTGCAGGTGGCAATCTTTCATTG
GTATGTTATCCATGCGCTCAGCTATTTTAGATGTGCTTAACTTTGCCATACTAGCTAATGAAAGGCTCATGGTTTCGC
GATTCGAAAAGGTCATGTCGAAGTTAGCCACCCTTGGACAAGTCCGCTCCCGCCTCACCGACTGTTCCGACGTAATCCCCGTTCCCCAAGTCCGACTCACCAAGCCCGTCACCATTCCCG
CTGGGAGAAGCATGGCTGACGTGGAAGCTGCT
GTAAGATATTCATCGTATCGCACAAGTATACCCTTTCACCCTACCTTCATAGTGTGCTGCCACCCCCTTCCCTGCTCTTTCTGCAGAT
CCCGGTCCAGTTACTACTGTTCCCCCTGTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCAAAGCTCTCTTCACTCTTACCGTGCTTGCCGTGTCCGCCTTTGCCGCTCCATCCAAGAAGGTCACTTGCAGCGGTGGAAGGACGACTAGCGATGCCAGCTGTTGCGTCTGG
TTCGACGTCCTGGACGACATTCAAGAGAACCT
ATTTGACGGTGCTGAGTGTGGCGAAGAAGTGCACGAGTCCCTTCGCTTGACGTTCCATGATGCTATCGGATTCTCCCCGAAGCTATCC
CGCCAAGGAAAGTTCGG
TGGTGGAGGCGCGGACGGTTCTCTCATGGCACATACGGAGATCGAGGCGGCCTTCAATGCAAACAACGGTATCGATGACATCGTCGAGGTCCAGAGGCCCTTC
GCCATCAAGCATAAAGTATCCTTTGGTGACTT
CATCCAATTTGCTGGTGCGGTTGGTGTAAGCAACTGTGCTGGAGGCCCCCGACTTGAATTCCTGGCTGGCCGTTCGAATCACTCCATC
GCATCCCCTGACCTCCTTGTCCCCGAGCCCAGCGACTCGGTGGATGCCATATTGGCCAGAATGGGAGATGCAGGTTTCAGCCCAGACGAGATCGTTGATCTTCTTGCCTCGCACAGTATC
GCAGCAGCTGATCACGTCGATGAGAGCATCCCC
GGGACCCCGTTCGACTCTACTCCGAGCGCTTTCGATGCGCAATTCTTCTTGGAAGTGCTTCTCAAAGGAACGCTTGTGCCAGGAAAT
GGCACCCACACCGGCCAGGCGCTTTCTCCTATCCCTGGTGAAATCCGCATCCAATCAGACTTCTTGCTTGCTCGCGACAGACGCACAGCCTGCAGGTGGCAATCTTTCATTG
CTAATGAA
AGGCTCATGGTTTCGCGATTCGAAAAGGTCATGTCGAAGTTAGCCACCCTTGGACAAGTCCGCTCCCGCCTCACCGACTGTTCCGACGTAATCCCCGTTCCCCAAGTCCGACTCACCAAG
CCCGTCACCATTCCCGCTGGGAGAAGCATGGCTGACGTGGAAGCTGCT
TGTGCTGCCACCCCCTTCCCTGCTCTTTCTGCAGATCCCGGTCCAGTTACTACTGTTCCCCCTGTGTGA

Retrieve as FASTA