Entry information : BcomCIIAC01
Entry ID 10526
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: BcomCIIAC01
Name BcomCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Baudoinia
Organism Baudoinia compniacensis    [TaxId: 430998 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BcomCIIAC01
start..stop
S start..stop
MfiCIIAC02 338 1e-116 49..325 39..317
CfulCIIAC01 332 4e-114 54..325 52..328
MpiCIIAC01 325 1e-111 35..325 10..318
MfiCIIAC01 323 1e-110 60..325 39..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 424096..424614 519 N° 2 424672..425133 462  
join(424096..424614,424672..425133)


exon

Literature and cross-references BcomCIIAC01
DNA ref. JGI genome:   scaffold_7 (424096..425133)
Cluster/Prediction ref. JGI gene:   148591
Protein sequence: BcomCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (305)
PWM (Da):   %s   34309.65 (32086.5)  
PI (pH):   %s   4.76 (4.66) Peptide Signal:   %s   cut: 22 range:22-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSHLTAATVVLSALLFAPSNASPALHARDWHSQSIAPFGFSSSTTASIPASSSTSTSSGCPAVWSTVATDLKSAFTGCNVLARNAIRFAFHDAAGYSSKTPYYAPATGGADGSLLLSSDEIKRQIEAPLQRYQPWLLGKYNKYHSQGVGAADLVQFAGNIGIRSCNGGPIVRTLVGRQDTSTAAPEGMLPEAFGQGSDYDTLVQLFLDKGFSATDLAALIGAHTVSQAFAEQGNGIPPGGPQDSTPTQWDTTYYKELQSDPRGVYHFQSDVNLGNQTTAVGMQMARFAQDEEAFDAAFADAMGRMNLLGISEEVSSGFADCTSLVQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCATCTCACAGCCGCTACCGTGGTGTTGTCTGCATTGCTCTTCGCCCCTTCAAATGCATCACCAGCACTGCACGCTCGCGACTGGCACTCGCAGTCGATTGCTCCTTTCGGTTTC
AGCAGCTCTACAACCGCATCTATACCGGCATCGAGCTCTACGTCTACATCTTCCGGCTGCCCCGCCGTCTGGTCAACCGTTGCGACGGACCTGAAATCGGCCTTCACGGGCTGCAACGTC
CTGGCACGAAACGCGATTCGTTTCGCCTTCCACGATGCTGCCGGATACAGCAGTAAGACGCCTTACTACGCCCCAGCGACTGGTGGCGCTGATGGATCCTTGCTACTAAGCAGCGATGAG
ATCAAGCGTCAGATCGAAGCGCCGTTGCAGAGATATCAACCCTGGTTACTAGGCAAGTACAACAAGTACCATAGCCAGGGCGTTGGTGCCGCGGATCTGGTGCAGTTTGCCGGCAACATT
GGCATCAGGAGCTGCAACGGTGGGCCTATCGTGAGGACT
GTATGCTAAGAATTCTACCCTCCTACGCTAGCATACTGAAACTAACCAACCATACAGCTCGTAGGTCGCCAAGACACCTCC
ACCGCAGCCCCAGAAGGCATGCTTCCAGAAGCCTTCGGCCAAGGTTCAGACTACGACACCCTTGTCCAGCTGTTCTTAGACAAAGGCTTCAGCGCAACAGATCTCGCCGCGCTTATCGGC
GCACATACCGTCTCTCAAGCCTTCGCCGAACAAGGCAATGGTATCCCACCCGGCGGACCCCAGGACTCAACGCCGACGCAGTGGGACACGACCTACTACAAGGAGCTGCAGAGTGATCCG
CGTGGCGTTTACCACTTCCAGAGCGATGTGAATCTGGGTAACCAGACCACTGCGGTTGGTATGCAGATGGCGAGGTTTGCGCAGGATGAGGAAGCGTTTGATGCGGCGTTTGCGGATGCT
ATGGGGAGGATGAATTTATTGGGTATTTCGGAGGAGGTTAGTAGTGGGTTTGCCGATTGTACGAGTCTGGTTCAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGCATCTCACAGCCGCTACCGTGGTGTTGTCTGCATTGCTCTTCGCCCCTTCAAATGCATCACCAGCACTGCACGCTCGCGACTGGCACTCGCAGTCGATTGCTCCTTTCGGTTTC
AGCAGCTCTACAACCGCATCTATACCGGCATCGAGCTCTACGTCTACATCTTCCGGCTGCCCCGCCGTCTGGTCAACCGTTGCGACGGACCTGAAATCGGCCTTCACGGGCTGCAACGTC
CTGGCACGAAACGCGATTCGTTTCGCCTTCCACGATGCTGCCGGATACAGCAGTAAGACGCCTTACTACGCCCCAGCGACTGGTGGCGCTGATGGATCCTTGCTACTAAGCAGCGATGAG
ATCAAGCGTCAGATCGAAGCGCCGTTGCAGAGATATCAACCCTGGTTACTAGGCAAGTACAACAAGTACCATAGCCAGGGCGTTGGTGCCGCGGATCTGGTGCAGTTTGCCGGCAACATT
GGCATCAGGAGCTGCAACGGTGGGCCTATCGTGAGGACT
CTCGTAGGTCGCCAAGACACCTCCACCGCAGCCCCAGAAGGCATGCTTCCAGAAGCCTTCGGCCAAGGTTCAGACTACGAC
ACCCTTGTCCAGCTGTTCTTAGACAAAGGCTTCAGCGCAACAGATCTCGCCGCGCTTATCGGCGCACATACCGTCTCTCAAGCCTTCGCCGAACAAGGCAATGGTATCCCACCCGGCGGA
CCCCAGGACTCAACGCCGACGCAGTGGGACACGACCTACTACAAGGAGCTGCAGAGTGATCCGCGTGGCGTTTACCACTTCCAGAGCGATGTGAATCTGGGTAACCAGACCACTGCGGTT
GGTATGCAGATGGCGAGGTTTGCGCAGGATGAGGAAGCGTTTGATGCGGCGTTTGCGGATGCTATGGGGAGGATGAATTTATTGGGTATTTCGGAGGAGGTTAGTAGTGGGTTTGCCGAT
TGTACGAGTCTGGTTCAGTGA

Retrieve as FASTA