Entry information : HcyCIIBC01
Entry ID 10528
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyCIIBC01
Name HcyCIIBC01
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyCIIBC01
start..stop
S start..stop
HcyCIIBC02 599 0 1..355 1..360
ApraCIIBC01 531 0 1..355 1..358
GmarCIIBC 527 0 1..352 1..354
GmarCIIBC06 514 0 1..352 1..354
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84080..84194 115 N° 2 83907..84026 120 N° 3 83791..83853 63 N° 4 83723..83735 13
N° 5 83609..83674 66 N° 6 83333..83549 217 N° 7 83219..83274 56 N° 8 82996..83162 167
N° 9 82761..82933 173 N° 10 82634..82698 65 N° 11 82569..82581 13  
complement(join(82569..82581,82634..82698,82761..82933,82996..83162,83219..83274 ,83333..83549,83609..83674,83723..83735,83791..83853,83907..84026,84080..84194))


exon

Literature and cross-references HcyCIIBC01
DNA ref. JGI genome:   scaffold_11 (84194..82569)
Cluster/Prediction ref. JGI gene:   47721
Protein sequence: HcyCIIBC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (333)
PWM (Da):   %s   36603.38 (34403.2)  
PI (pH):   %s   4.61 (4.52) Peptide Signal:   %s   cut: 23 range:23-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSAIVALALGASQLASAATTCSTGQTTAHAACCSLFPVVDLLQKELFDGGECGEEAHSALRLSFHDAIGFSTKGGKGGGADGSILAFNKTENAFHANAGIDDITDRQFPVFVKSGLSAGDFVHLAAAVGIANCAGAPSLLFFSGRPPPVAAAPDLTVPEPTDDVTSILARFADAGFSPPEAIALLASHTIAAADQVDPSIPGTPFDSTVTTFDSQVFLEVLLKGKSFPGATGQPGEVLSPLAGEMRLQSDFRLSQDPRTACFWQAFINQQSLMTFAFKLVMAKMQLLGQDVSKLTDCSDVVPKSTAFSGPIKYPASFSQADVQQACQILPFPSLATVAGPAPTVAPVPGS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCTCGCCTTTCAGCTATCGTCGCTCTCGCTCTCGGAGCATCTCAGCTCGCTTCAGCTGCTACTACTTGTTCCACCGGCCAAACCACCGCCCATGCTGCATGCTGTTGTTCG
TATCGTTTACACCCTGCAAGAAAATTAGTTATCTGAGTCTATCCGTAGCGCTCTTCCCCGTGGTTGACTTATTGCAGAAGGAACTTTTCGACGGCGGCGAGTGTGGTGAAGAGGCTCACT
CTGCCCTTCGTCTGTCCTTCCATGACGCCATCGGTTTCTCCACTAAAG
GTTTGTTTCTACGTTTTGAAAGGGTCATTAACATCTTTCAACGTATAATATAGGAGGAAAGGGTGGAGGAGC
TGACGGCTCTATCTTGGCCTTCAACAAGACTGAGAATGCGTTCC
GTGAGTCTCTTTTATTTTCTTTGTTCTTGTCACATTCTTATCAAACTACCCACAGATGCTAACGCAGGGTAATGCA
CTCTGTCAAATTTCTCAACGCCCTCTAATTTTGTCTTCAGAATCGACGACATCACTGATCGCCAGTTCCCTGTCTTCGTCAAGTCTGGCCTGAGTGCCGGTGACTTGTAAGTGCCATCCC
GCATTCATTCATAAGCCCGGACATTCTCTAAACATTTTCGTCCAGTGTCCACCTCGCCGCTGCTGTTGGAATTGCCAACTGCGCTGGTGCACCCAGCCTTTTGTTCTTTTCCGGTCGCCC
GCCCCCGGTCGCCGCCGCTCCCGATTTGACCGTGCCAGAGCCAACGGACGACGTCACCAGCATCTTGGCGAGGTTCGCCGATGCTGGGTTCTCCCCTCCTGAGGCCATCGCTCTGCTTGC
ATCCCACACCATCGCTGCCGCC
GTAAGTTTGAATTACCTCGTAGCCTTCATTCCCTGCTGATGGATAAATTTGAATATAGGATCAGGTTGACCCATCCATTCCAGGAACTCCCTTCGACA
GTACCGTTACCACATT
GTATGTCTTGATTTAACTCTGACGACGAGAACGAAGGGCGCTGATCTATAAATTAGCGACTCTCAGGTTTTCCTCGAGGTCCTTCTCAAGGGCAAGTCGTTCCC
AGGTGCCACCGGCCAACCTGGAGAAGTCCTCTCCCCATTGGCAGGTGAAATGCGTCTTCAGAGTGACTTCAGACTCTCGCAGGACCCCAGGACCGCCTGCTTCTGGCAAGCCTTTATCA
G
TATGTCCTACATCTAAGTTAGGTAGGGAGTTACATGCTGATACAACGGTTTTACGCAACAGACCAACAGTCATTGATGACCTTCGCATTCAAGCTTGTTATGGCCAAGATGCAACTTCTC
GGTCAAGACGTCAGCAAGCTCACCGACTGCTCTGATGTCGTCCCGAAATCCACTGCCTTCAGTGGACCAATCAAATACCCGGCTTCGTTCTCGCAGGCGGATGTTCAGCAAGCC
GTCAGT
GGTTTTTTCGCTCTTCTATCGAATTTCGGAATTTTTGTGCTGAATTATTATTCTAGTGCCAAATACTGCCCTTCCCCAGTCTTGCTACCGTTGCCGGGCCCGCCCCAACCGTTGCCCCTG
T
GTAAGTTCCTTCATTTCCTCCTTAGGATGCTTGCTGATAGAGGGTGCTTTAGTCCTGGGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCTCGCCTTTCAGCTATCGTCGCTCTCGCTCTCGGAGCATCTCAGCTCGCTTCAGCTGCTACTACTTGTTCCACCGGCCAAACCACCGCCCATGCTGCATGCTGTTCGCTC
TTCCCCGTGGTTGACTTATTGCAGAAGGAACTTTTCGACGGCGGCGAGTGTGGTGAAGAGGCTCACTCTGCCCTTCGTCTGTCCTTCCATGACGCCATCGGTTTCTCCACTAAAG
GAGGA
AAGGGTGGAGGAGCTGACGGCTCTATCTTGGCCTTCAACAAGACTGAGAATGCGTTCC
ATGCTAACGCAGGAATCGACGACATCACTGATCGCCAGTTCCCTGTCTTCGTCAAGTCTGGC
CTGAGTGCCGGTGACTT
TGTCCACCTCGCCGCTGCTGTTGGAATTGCCAACTGCGCTGGTGCACCCAGCCTTTTGTTCTTTTCCGGTCGCCCGCCCCCGGTCGCCGCCGCTCCCGATTTG
ACCGTGCCAGAGCCAACGGACGACGTCACCAGCATCTTGGCGAGGTTCGCCGATGCTGGGTTCTCCCCTCCTGAGGCCATCGCTCTGCTTGCATCCCACACCATCGCTGCCGCC
GATCAG
GTTGACCCATCCATTCCAGGAACTCCCTTCGACAGTACCGTTACCACATT
CGACTCTCAGGTTTTCCTCGAGGTCCTTCTCAAGGGCAAGTCGTTCCCAGGTGCCACCGGCCAACCTGGA
GAAGTCCTCTCCCCATTGGCAGGTGAAATGCGTCTTCAGAGTGACTTCAGACTCTCGCAGGACCCCAGGACCGCCTGCTTCTGGCAAGCCTTTATCA
ACCAACAGTCATTGATGACCTTC
GCATTCAAGCTTGTTATGGCCAAGATGCAACTTCTCGGTCAAGACGTCAGCAAGCTCACCGACTGCTCTGATGTCGTCCCGAAATCCACTGCCTTCAGTGGACCAATCAAATACCCGGCT
TCGTTCTCGCAGGCGGATGTTCAGCAAGCC
TGCCAAATACTGCCCTTCCCCAGTCTTGCTACCGTTGCCGGGCCCGCCCCAACCGTTGCCCCTGTTCCTGGGTCTTAA

Retrieve as FASTA