Entry information : HcyCIIBC02
Entry ID 10529
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyCIIBC02
Name HcyCIIBC02
Class Other class II peroxidase type C    [Orthogroup: CIIBC001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyCIIBC02
start..stop
S start..stop
HcyCIIBC01 606 0 1..360 1..355
GmarCIIBC06 530 0 1..357 1..354
GmarCIIBC 530 0 1..357 1..354
ApraCIIBC01 525 0 1..360 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 87564..87693 130 N° 2 87392..87511 120 N° 3 87271..87333 63 N° 4 87202..87214 13
N° 5 87086..87151 66 N° 6 86816..87032 217 N° 7 86707..86762 56 N° 8 86484..86650 167
N° 9 86249..86421 173 N° 10 86106..86170 65 N° 11 86041..86053 13  
complement(join(86041..86053,86106..86170,86249..86421,86484..86650,86707..86762 ,86816..87032,87086..87151,87202..87214,87271..87333,87392..87511,87564..87693))


exon

Literature and cross-references HcyCIIBC02
DNA ref. JGI genome:   scaffold_11 (87693..86041)
Cluster/Prediction ref. JGI gene:   47722
Protein sequence: HcyCIIBC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (338)
PWM (Da):   %s   37361.66 (35085.4)  
PI (pH):   %s   4.57 (4.49) Peptide Signal:   %s   cut: 23 range:23-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFARLSAIIALAFGASQLVSAAVVQRSTTCPSGQTTANATCCQLFPIVDLLQTQLFDGGECGEEAHSALRLAFHDAIGFSTSGGKGGGADGSILAFNKTENAFHANAGIDDITDRQFPVFLQSGLSAGDFVHLAAAVAVTNCVGGPSLKFFFGRPPPVAPAPDLTVPEPTDSVTSILARFDDAGFSPAEAIALLASHTIAAADQVDPSIPGTPFDSTVTTFDSQVFLEVLLKGKSFPGATGQPGEVLSPLAGEMRLQSDFRLSQDSRTACFWQAFINQQSLMTGAFKVVMAKMQVLGQNTKLLTDCSDVIPTSKPFTGPIKYPASFSQSDVQQACSQLPFPSLSTVSGPAPTVSPVPGS*

Retrieve as FASTA  
Remarks Complete sequence frpm genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCTCGCCTTTCAGCTATCATCGCTCTTGCTTTCGGAGCATCTCAGCTCGTCTCCGCTGCTGTGGTACAGCGGTCCACTACCTGCCCCAGTGGCCAAACTACCGCCAATGCA
ACATGTTGCC
GTCAGTATCATTTTAACCGTGGAGAAATCTCGTTGTCTGAGCATTTTGTTAGAGCTTTTCCCGATTGTTGACCTGCTGCAGACCCAGCTTTTCGATGGCGGCGAGTGTGG
TGAAGAGGCTCACTCTGCCCTTCGTCTGGCTTTCCACGATGCCATCGGTTTCTCCACTAGCG
GTTTGTTGTATTTTCTGAATTGTCATCGGCATTTCTCGACGTTTAATGTTTAATATAG

GTGGAAAGGGAGGAGGAGCGGACGGCTCTATCCTGGCCTTCAACAAGACTGAGAACGCATTCC
GTACGTCTCTTATTCTATTCTTATTTTTCTTACATGCTCATCGGACAACCCGACAGA
CGCTAACGCAGG
GTATAGCTAACTTTCTCAATGTTCTCAACAAGCTCTAACCTAGCCTTCAGAATCGATGACATCACCGATCGCCAGTTCCCTGTCTTCCTCCAATCCGGCCTGAGCGCT
GGTGACTT
GTAAGCACCACACAATCATAGTCCAGGAATTCTATATAATGATTTGACTTCAGTGTCCACCTGGCCGCTGCCGTCGCTGTTACCAACTGCGTTGGGGGACCTAGCCTCAAGT
TCTTTTTCGGTCGCCCTCCCCCGGTCGCCCCTGCTCCTGATCTGACCGTTCCGGAGCCAACTGACAGCGTTACCAGCATCTTGGCGAGGTTCGACGATGCGGGATTCTCCCCTGCTGAGG
CCATCGCTCTGCTTGCATCCCACACCATCGCTGCCGCC
GTAAGTTTGACTCATCCCTCATTCTGAACTCCCAGCTTGATGAACCAATATAGGATCAAGTTGACCCAAGCATTCCGGGAAC
TCCCTTCGACAGTACCGTTACCACCTT
GTATGTCTTGCTTTAATTCTGACGACGAGAACAAAGGGTGCTGATCTATAAATTAGCGACTCCCAGGTTTTCCTCGAGGTCCTTCTCAAGGGC
AAGTCGTTCCCAGGTGCTACCGGCCAACCTGGCGAAGTCCTGTCCCCATTGGCAGGTGAAATGCGTCTCCAGAGCGACTTCAGGCTCTCGCAAGATTCCAGGACCGCCTGTTTCTGGCAA
GCCTTTATCA
GTGTGTCATACATCTGACTTGGGTTAGGCGTTACATGCTGATACAACGGTTTTACGCAACAGACCAACAGTCGTTGATGACCGGCGCGTTCAAGGTCGTTATGGCCAAGA
TGCAAGTCCTCGGTCAAAACACCAAGCTGCTTACCGACTGCTCTGATGTCATCCCGACGTCCAAGCCCTTCACTGGACCCATCAAGTATCCAGCTTCGTTCTCGCAGTCGGATGTCCAAC
AAGCC
GTCAGTTTATTTTCTCCATTTCATTCCGAGTTTTCAAATTATTGATGTTTCGAATTCTTTTTTTTCCTTCTTGGCTAGTGCTCTCAACTGCCATTCCCTAGTCTTTCCACCGTTT
CTGGGCCCGCCCCAACCGTATCCCCTGT
GTAAGCTCCATCGTTGCCTTCTGTTGCACGATTACTGATAGGTGCTCTCTAGTCCTGGGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCGCTCGCCTTTCAGCTATCATCGCTCTTGCTTTCGGAGCATCTCAGCTCGTCTCCGCTGCTGTGGTACAGCGGTCCACTACCTGCCCCAGTGGCCAAACTACCGCCAATGCA
ACATGTTGCC
AGCTTTTCCCGATTGTTGACCTGCTGCAGACCCAGCTTTTCGATGGCGGCGAGTGTGGTGAAGAGGCTCACTCTGCCCTTCGTCTGGCTTTCCACGATGCCATCGGTTTC
TCCACTAGCG
GTGGAAAGGGAGGAGGAGCGGACGGCTCTATCCTGGCCTTCAACAAGACTGAGAACGCATTCCACGCTAACGCAGGAATCGATGACATCACCGATCGCCAGTTCCCTGTC
TTCCTCCAATCCGGCCTGAGCGCTGGTGACTT
TGTCCACCTGGCCGCTGCCGTCGCTGTTACCAACTGCGTTGGGGGACCTAGCCTCAAGTTCTTTTTCGGTCGCCCTCCCCCGGTCGCC
CCTGCTCCTGATCTGACCGTTCCGGAGCCAACTGACAGCGTTACCAGCATCTTGGCGAGGTTCGACGATGCGGGATTCTCCCCTGCTGAGGCCATCGCTCTGCTTGCATCCCACACCATC
GCTGCCGCC
GATCAAGTTGACCCAAGCATTCCGGGAACTCCCTTCGACAGTACCGTTACCACCTTCGACTCCCAGGTTTTCCTCGAGGTCCTTCTCAAGGGCAAGTCGTTCCCAGGTGCT
ACCGGCCAACCTGGCGAAGTCCTGTCCCCATTGGCAGGTGAAATGCGTCTCCAGAGCGACTTCAGGCTCTCGCAAGATTCCAGGACCGCCTGTTTCTGGCAAGCCTTTATCA
ACCAACAG
TCGTTGATGACCGGCGCGTTCAAGGTCGTTATGGCCAAGATGCAAGTCCTCGGTCAAAACACCAAGCTGCTTACCGACTGCTCTGATGTCATCCCGACGTCCAAGCCCTTCACTGGACCC
ATCAAGTATCCAGCTTCGTTCTCGCAGTCGGATGTCCAACAAGCC
TGCTCTCAACTGCCATTCCCTAGTCTTTCCACCGTTTCTGGGCCCGCCCCAACCGTATCCCCTGTTCCTGGGTCT
TAA

Retrieve as FASTA