Entry information : OsPrx43
Entry ID 1053
Creation 2006-09-18 (Filippo Passardi)
Last sequence changes 2006-09-18 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx43
Name OsPrx43
Class Class III peroxidase    [Orthogroup: Prx122]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor Pathogen interaction
Best BLASTp hits
Perox score E-value OsPrx43
start..stop
S start..stop
OsPrx42 657 0 1..323 1..323
OsPrx44 558 0 1..323 1..323
SiPrx172 532 0 1..323 1..322
SiPrx170 529 0 3..323 2..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14278725..14278934 210 N° 2 14279045..14279806 762  
join(14278725..14278934,14279045..14279806)


exon

Literature and cross-references OsPrx43
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1Q0
DNA ref. GenBank:   NC_008396.1 (14278725..14279803)
Protein sequence: OsPrx43
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (299)
PWM (Da):   %s   34266.34 (32068.3)  
PI (pH):   %s   8.26 (8.20) Peptide Signal:   %s   cut: 25 range:25-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASGMKLAVAVACALALASACHGLQLGYYKQSCPRVEAIVRDEVKKFVYKDAGIGAGLIRLVFHDCFVEGCDGSVLLDPTPANPKPEKLSPPNMPSLRGFEVIDAAKDAVEKVCPGVVSCADIVAFAARDAAYFLSRFRVKINVPGGRLDGRRSLDSDALNNLPPPNFNVNQLIGAFAAKGLDAEDMVVLSGAHTVGRSHCSSFVSDRVAAPSDINGGFANFLKQRCPANPTSSNDPTVNQDAVTPNAFDNQYYKNVVAHKVLFASDAALLTSPATAKMVSDNANIPGWWEDKFAKAFVKMASVGVKTGYPGEIRRHCRVVN*

Retrieve as FASTA  
Remarks chromosome 3; 21 ESTs (UniGene Os.19737), (http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=13165030) and AU184429 (http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=nucleotide&val=14192218). Probable sequencing errot (poor resolution) in AU184429. Accessions AU173827 and AU184429 have the same homology to OsPrx42 and OsPrx43!!
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCATCGGGCATGAAGCTCGCCGTGGCGGTGGCGTGCGCGCTGGCGCTCGCGTCGGCGTGCCACGGCCTGCAGCTGGGCTACTACAAGCAGTCGTGCCCCCGCGTGGAGGCCATC
GTGAGGGACGAGGTGAAGAAGTTCGTCTACAAGGACGCCGGCATCGGCGCCGGACTCATCCGCCTCGTCTTCCACGACTGCTTCGTCGAG
GTATGTCGCATTGCATTTCTGAATCACAAA
TTTGCAATCCATGGCGGCAGTGAGATGAGATCAATGTGAGCGTGACAGATCATCATATGCATGTATGTGTTTGTTGATAGGGATGTGATGGCTCGGTGCTCCTGGACCCAACTCCGGCGA
ACCCGAAGCCGGAGAAGCTCAGCCCGCCCAACATGCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCCGCCAAGGACGCCGTCGAGAAGGTCTGCCCCGGCGTGGTCTCGTGCGCCGACA
TCGTCGCCTTCGCCGCCCGCGACGCCGCCTACTTCCTCAGCAGATTCAGGGTCAAGATCAACGTCCCAGGTGGACGCCTCGATGGCCGCCGCTCCCTCGACTCCGACGCCCTCAACAACC
TGCCGCCGCCCAACTTCAACGTGAACCAGCTCATCGGCGCGTTCGCCGCCAAGGGCCTCGACGCCGAGGACATGGTGGTGCTCTCCGGCGCCCACACCGTCGGCCGCTCCCACTGCTCCT
CCTTCGTCTCGGACCGCGTCGCCGCGCCCTCCGACATCAACGGCGGCTTCGCCAACTTCCTCAAGCAGAGGTGCCCGGCCAACCCGACCTCCAGCAACGACCCGACGGTGAACCAGGACG
CCGTCACGCCCAACGCGTTCGACAACCAGTACTACAAGAACGTGGTGGCGCACAAGGTGCTCTTCGCGTCGGACGCGGCGCTGCTGACGTCGCCGGCGACGGCGAAGATGGTGTCGGACA
ACGCCAACATCCCGGGGTGGTGGGAGGACAAGTTCGCCAAGGCGTTCGTCAAGATGGCATCCGTCGGTGTCAAGACCGGCTACCCCGGCGAGATCAGGAGGCACTGCAGGGTCGTCAACT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCATCGGGCATGAAGCTCGCCGTGGCGGTGGCGTGCGCGCTGGCGCTCGCGTCGGCGTGCCACGGCCTGCAGCTGGGCTACTACAAGCAGTCGTGCCCCCGCGTGGAGGCCATC
GTGAGGGACGAGGTGAAGAAGTTCGTCTACAAGGACGCCGGCATCGGCGCCGGACTCATCCGCCTCGTCTTCCACGACTGCTTCGTCGAG
GGATGTGATGGCTCGGTGCTCCTGGACCCA
ACTCCGGCGAACCCGAAGCCGGAGAAGCTCAGCCCGCCCAACATGCCCAGCCTCCGCGGCTTCGAGGTGATCGACGCCGCCAAGGACGCCGTCGAGAAGGTCTGCCCCGGCGTGGTCTCG
TGCGCCGACATCGTCGCCTTCGCCGCCCGCGACGCCGCCTACTTCCTCAGCAGATTCAGGGTCAAGATCAACGTCCCAGGTGGACGCCTCGATGGCCGCCGCTCCCTCGACTCCGACGCC
CTCAACAACCTGCCGCCGCCCAACTTCAACGTGAACCAGCTCATCGGCGCGTTCGCCGCCAAGGGCCTCGACGCCGAGGACATGGTGGTGCTCTCCGGCGCCCACACCGTCGGCCGCTCC
CACTGCTCCTCCTTCGTCTCGGACCGCGTCGCCGCGCCCTCCGACATCAACGGCGGCTTCGCCAACTTCCTCAAGCAGAGGTGCCCGGCCAACCCGACCTCCAGCAACGACCCGACGGTG
AACCAGGACGCCGTCACGCCCAACGCGTTCGACAACCAGTACTACAAGAACGTGGTGGCGCACAAGGTGCTCTTCGCGTCGGACGCGGCGCTGCTGACGTCGCCGGCGACGGCGAAGATG
GTGTCGGACAACGCCAACATCCCGGGGTGGTGGGAGGACAAGTTCGCCAAGGCGTTCGTCAAGATGGCATCCGTCGGTGTCAAGACCGGCTACCCCGGCGAGATCAGGAGGCACTGCAGG
GTCGTCAACTAA

Retrieve as FASTA