Entry information : StheCcP
Entry ID 10530
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-27 (Catherine Mathe (Scipio))
Peroxidase information: StheCcP
Name StheCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Thielavia
Organism Sporotrichum thermophile (Myceliophthora thermophila)    [TaxId: 573728 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value StheCcP
start..stop
S start..stop
CgCcP 647 0 1..355 1..355
TterCcP01 630 0 1..355 1..357
CtheCcP01 629 0 1..351 1..351
NcCcP 602 0 3..355 6..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1780176..1780656 481 N° 2 1780734..1781107 374 N° 3 1781174..1781383 210  
join(1780176..1780656,1780734..1781107,1781174..1781383)


exon

Literature and cross-references StheCcP
DNA ref. JGI genome:   chromosome_1 (1780176..1781383)
EST ref. GenBank:   GT935301.1 [3' end]
Cluster/Prediction ref. JGI gene:   2294840
Protein sequence: StheCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356
PWM (Da):   %s   39736.73  
PI (pH):   %s   8.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATATRTFTRALRTSARPAFAAAPRVAFRQAGRRFYSSEPAPKSSSSAWIWAAGAAAAGAGGWYFLNNQSSATPQVFKPKYEDYQAVYNEIANRLEENSDYDDGSYGPVLLRLAWHASGTYDKETGTGGSNGATMRFSPEADHGANAGLKAARDFLEPVKQKFPWISYSDLWILAGVCAIQEMLGPQIPFRPGRQDKDVSACTPDGRLPDAAQGQDHLRNIFYRMGFNDQEIVALAGAHALGRCHTDRSGYSGPWTFSPTVLTNDYYKLLLDEKWQWKKWNGPKQYEDKKTKSLMMLPADMALVQDKKFKEWVQKYAADNDLFFRDFAAVITKLFELGVPFPENTERWVFKPVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTGCAACTCGCACCTTCACCCGCGCCCTGCGCACCTCGGCCCGGCCCGCCTTCGCCGCCGCTCCCCGGGTGGCATTCCGCCAGGCTGGCCGTCGCTTCTACTCGTCGGAGCCT
GCTCCGAAGAGCAGCTCGTCGGCGTGGATCTGGGCTGCCGGTGCCGCCGCTGCCGGTGCCGGTGGCTGGTACTTCCTGAACAACCAGAGCTCGGCCACTCCCCAGGTCTTCAAGCCCAAG
TACGAGGACTACCAGGCCGTGTACAACGAGATTGCGAACCGCCTCGAGGAGAACTCGGATTATGACGATGGCAGCTATGGCCCTGTGCTGCTGCGTCTCGCCTGGCACGCCAGCGGCACC
TATGACAAGGAGACCGGCACCGGCGGCAGCAACGGCGCCACCATGCGCTTCTCTCCGGAGGCCGATCACGGCGCCAACGCCGGCCTGAAGGCTGCGCGGGATTTCCTTGAGCCTGTGAAG
C
GTAAGTCCCGCGACGATTGATCGTCAAACCAAAAAAAAGAAAAAGGAAATCTCCGATCGACTGACATACAATCACAGAGAAGTTCCCTTGGATTTCTTACTCTGATCTCTGGATCCTCG
CTGGCGTCTGCGCCATCCAGGAGATGCTGGGCCCCCAGATTCCCTTCCGCCCCGGCCGCCAGGACAAGGATGTCTCCGCCTGCACCCCCGACGGCCGCCTCCCTGATGCCGCCCAGGGCC
AGGACCACCTGCGCAACATCTTCTATCGCATGGGCTTCAACGACCAGGAGATTGTTGCTCTGGCTGGCGCGCACGCTCTCGGCCGCTGCCACACCGACCGCTCCGGCTACTCTGGCCCCT
GGACCTTCTCGCCCACCGTCCTGACCAACGACTACTACAAGCTGCTGCTTGACGAGAAGTGGCAGTGGAAGAAGTGGAACGGCCCCAAGCAG
GTGAGTCAGCTCGATCGAGTTTCGTGAA
GGGTTCGAAGGGAGCAGGTCTCTAACGCCGGGAAACAGTACGAGGACAAGAAGACCAAGTCGCTCATGATGCTGCCGGCCGACATGGCGCTCGTCCAGGACAAGAAGTTCAAGGAGTGGG
TTCAGAAGTACGCTGCCGACAACGACCTGTTCTTCAGGGATTTCGCAGCCGTTATCACCAAGCTGTTTGAGCTCGGTGTGCCCTTCCCCGAGAACACGGAGCGGTGGGTTTTCAAGCCCG
TCAACGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACTGCAACTCGCACCTTCACCCGCGCCCTGCGCACCTCGGCCCGGCCCGCCTTCGCCGCCGCTCCCCGGGTGGCATTCCGCCAGGCTGGCCGTCGCTTCTACTCGTCGGAGCCT
GCTCCGAAGAGCAGCTCGTCGGCGTGGATCTGGGCTGCCGGTGCCGCCGCTGCCGGTGCCGGTGGCTGGTACTTCCTGAACAACCAGAGCTCGGCCACTCCCCAGGTCTTCAAGCCCAAG
TACGAGGACTACCAGGCCGTGTACAACGAGATTGCGAACCGCCTCGAGGAGAACTCGGATTATGACGATGGCAGCTATGGCCCTGTGCTGCTGCGTCTCGCCTGGCACGCCAGCGGCACC
TATGACAAGGAGACCGGCACCGGCGGCAGCAACGGCGCCACCATGCGCTTCTCTCCGGAGGCCGATCACGGCGCCAACGCCGGCCTGAAGGCTGCGCGGGATTTCCTTGAGCCTGTGAAG
C
AGAAGTTCCCTTGGATTTCTTACTCTGATCTCTGGATCCTCGCTGGCGTCTGCGCCATCCAGGAGATGCTGGGCCCCCAGATTCCCTTCCGCCCCGGCCGCCAGGACAAGGATGTCTCC
GCCTGCACCCCCGACGGCCGCCTCCCTGATGCCGCCCAGGGCCAGGACCACCTGCGCAACATCTTCTATCGCATGGGCTTCAACGACCAGGAGATTGTTGCTCTGGCTGGCGCGCACGCT
CTCGGCCGCTGCCACACCGACCGCTCCGGCTACTCTGGCCCCTGGACCTTCTCGCCCACCGTCCTGACCAACGACTACTACAAGCTGCTGCTTGACGAGAAGTGGCAGTGGAAGAAGTGG
AACGGCCCCAAGCAG
TACGAGGACAAGAAGACCAAGTCGCTCATGATGCTGCCGGCCGACATGGCGCTCGTCCAGGACAAGAAGTTCAAGGAGTGGGTTCAGAAGTACGCTGCCGACAAC
GACCTGTTCTTCAGGGATTTCGCAGCCGTTATCACCAAGCTGTTTGAGCTCGGTGTGCCCTTCCCCGAGAACACGGAGCGGTGGGTTTTCAAGCCCGTCAACGCC

Retrieve as FASTA