Entry information : HpulCIIAA[P]02
Entry ID 10532
Creation 2012-02-27 (Christophe Dunand)
Last sequence changes 2012-11-06 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-11-06 (Christophe Dunand)
Peroxidase information: HpulCIIAA[P]02
Name HpulCIIAA[P]02
Class Asco Class II type A     [Orthogroup: CIIAA001]*
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Hysteriaceae Hysterium
Organism Hysterium pulicare    [TaxId: 100027 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpulCIIAA[P]02
start..stop
S start..stop
RrufCIIAA03 439 3e-155 1..285 115..403
LfluCIIAA04 415 6e-146 1..278 112..392
GsteCIIAA04 406 2e-142 1..282 113..397
SturCIIAA02 401 2e-140 1..281 113..399
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 182402..183037 636 N° 2 183098..183310 213 N° 3 183364..183456 93  
join(182402..183037,183098..183310,183364..183456)


exon

Literature and cross-references HpulCIIAA[P]02
DNA ref. JGI genome:   NODE_532_length_286818_cov_26.666451 (182402..183456)
Cluster/Prediction ref. JGI gene:   8795
Protein sequence: HpulCIIAA[P]02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313
PWM (Da):   %s   34246.92  
PI (pH):   %s   6.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FNGTSGRGTKYARGAVRLGFHDAAVWSTSTSYGGADGSILLSDEMSRSDNNGLSPVADQMTAWYGKFHQYGVGMADLIQMGANIATVVYPLGPRLRSFIGRNDN*PTGLLPDVNDSADNLINLFKAKTIDTTDVVALLGAHTTIQHHFVNTTRDGDHQDSTPGEWDVAFYGQTTKSVPPRIFKFPSDVKLSQDSQTKPDWTKSTGNQGRWNAVHSQAYTRLSLLGVNNTNDLKECTKVLPPARTSFVSQDQAVLDLWLQGQFDRLNNFVDEAQMLTGLTGTTCYPLDILKRYRTFQEGNPPMSHGTSAKINQER

Retrieve as FASTA  
Remarks Pseudogene fr'om genomic ( 2 introns and a stop codon in frame, large 5'end is missing). Prediction from JGI (extra intron to remove the stop codon).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCAACGGAACATCTGGACGGGGCACCAAATACGCTCGCGGGGCCGTTCGTCTAGGCTTCCACGATGCGGCAGTATGGTCAACCTCAACTTCTTACGGAGGCGCTGACGGTAGCATCCTT
CTCTCCGACGAAATGAGTCGCTCCGACAACAATGGTCTTTCGCCTGTCGCAGACCAGATGACTGCCTGGTACGGCAAATTTCACCAATACGGAGTGGGCATGGCCGATCTTATTCAGATG
GGCGCCAACATTGCAACGGTCGTCTATCCACTTGGTCCGCGTCTCCGCTCCTTCATTGGTCGAAATGATAATTGACCAACAGGTCTCCTCCCGGACGTCAACGACTCCGCGGACAATTTG
ATCAATCTTTTCAAGGCCAAGACCATCGATACAACGGACGTGGTAGCTCTCCTAGGGGCGCACACTACGATTCAGCACCATTTCGTCAACACCACTCGCGATGGAGATCATCAGGATTCC
ACGCCAGGAGAGTGGGACGTCGCATTCTACGGTCAAACGACGAAAAGCGTGCCACCACGGATCTTCAAGTTCCCAAGCGATGTCAAGCTATCTCAAGACTCCCAAACGAAACCTGATTGG
ACGAAGTCTACCGGAAATCAAGGGAGATGGAATGCG
GTAAGCGCTGGCTTCCTCAAACTAACTTCCTAGTGTATAGGCTGACCTTTCGATTCCCAGGTACACTCGCAGGCATACACGAGA
CTCAGCTTACTCGGCGTGAATAATACAAACGATTTGAAGGAGTGTACCAAAGTTCTTCCGCCGGCGCGAACCTCGTTCGTGAGCCAGGATCAGGCTGTCTTGGATCTGTGGTTGCAGGGT
CAATTTGATCGGCTAAATAACTTTGTGGATGAGGCTCAGATGCTCACGGGGCTCACTGGGACTACTTGC
GTTAATGGTTTTTTATTAATAGTAGAAATGATTCCTGACTTCCTATCTCAT
AGTATCCATTAGATATCTTGAAACGCTATAGAACGTTCCAGGAAGGAAACCCGCCCATGAGCCATGGGACGAGCGCCAAGATCAACCAGGAACGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCAACGGAACATCTGGACGGGGCACCAAATACGCTCGCGGGGCCGTTCGTCTAGGCTTCCACGATGCGGCAGTATGGTCAACCTCAACTTCTTACGGAGGCGCTGACGGTAGCATCCTT
CTCTCCGACGAAATGAGTCGCTCCGACAACAATGGTCTTTCGCCTGTCGCAGACCAGATGACTGCCTGGTACGGCAAATTTCACCAATACGGAGTGGGCATGGCCGATCTTATTCAGATG
GGCGCCAACATTGCAACGGTCGTCTATCCACTTGGTCCGCGTCTCCGCTCCTTCATTGGTCGAAATGATAATTGACCAACAGGTCTCCTCCCGGACGTCAACGACTCCGCGGACAATTTG
ATCAATCTTTTCAAGGCCAAGACCATCGATACAACGGACGTGGTAGCTCTCCTAGGGGCGCACACTACGATTCAGCACCATTTCGTCAACACCACTCGCGATGGAGATCATCAGGATTCC
ACGCCAGGAGAGTGGGACGTCGCATTCTACGGTCAAACGACGAAAAGCGTGCCACCACGGATCTTCAAGTTCCCAAGCGATGTCAAGCTATCTCAAGACTCCCAAACGAAACCTGATTGG
ACGAAGTCTACCGGAAATCAAGGGAGATGGAATGCG
GTACACTCGCAGGCATACACGAGACTCAGCTTACTCGGCGTGAATAATACAAACGATTTGAAGGAGTGTACCAAAGTTCTTCCG
CCGGCGCGAACCTCGTTCGTGAGCCAGGATCAGGCTGTCTTGGATCTGTGGTTGCAGGGTCAATTTGATCGGCTAAATAACTTTGTGGATGAGGCTCAGATGCTCACGGGGCTCACTGGG
ACTACTTGC
TATCCATTAGATATCTTGAAACGCTATAGAACGTTCCAGGAAGGAAACCCGCCCATGAGCCATGGGACGAGCGCCAAGATCAACCAGGAACGA

Retrieve as FASTA